KEGG   Empidonax traillii (willow flycatcher): 114059625
Entry
114059625         CDS       T05887                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X1
  KO
K04439  beta-arrestin
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04144  Endocytosis
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114059625 (ARRB1)
   04340 Hedgehog signaling pathway
    114059625 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114059625 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114059625 (ARRB1)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    114059625 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 114059625
NCBI-ProteinID: XP_027744067
LinkDB
Position
Unknown
AA seq 465 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCA
FRYGREDLDVLGLTFRKDLFVANSQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAVEDADDMVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPREEP
AHRDIPENEAPIDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEDEEERTNSPQLNDSGS
LRIARWPQDLLLSSCAVLSLFIQLPELLFPVQGTAGGCWRQGGSL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggagacaaaggcacccgggtgtttaagaaagccagtcccaacgggaagctcactgtc
tacctggggaagagggattttgtggatcacatcgacgtggtggaccccgtggatggagtg
gtgcttgtggatcctgaatacctgaaggagagaaaagtgttcgtgacgctgacctgcgcg
ttccgctatggccgcgaggacctggacgtgctggggctgaccttccgcaaggacctgttc
gtggccaactctcaggccttcccgccggtccccgaggagaagaagcccctgacgcggctg
caggagcggctcatcaagaagctgggcgagcatgcctaccccttcaccttcgagatcccc
cccaacctgccttgctctgtcacgctgcagccgggcccagaggacacggggaaggcctgt
ggggtggactatgaggtcaaagctttctgtgctgagaacctggaggagaagatccacaag
aggaactcggtgcgcctggtgattcggaaggtccagtatgcgccggagcggcctggcccc
cagcccatggcagagaccacccggcagttcctcatgtcagacaaaccgctgcacctcgag
gcctccctggacaaggagatctactaccacggagagcccatcagcgtcaacgtccacgtc
accaacaacaccaacaagaccgtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgcctcttcaacaccgcccagtacaagtgcccggtggctgtggaggacgctgatgat
atggtggccccgagctcgaccttctgcaaagtctacaccctgacccccttccttgccaac
aaccgggagaagcgggggctggcactggatgggaagctcaagcacgaggacaccaacctg
gcctccagcacgctgttaagagatggagccaacaaggagatcctgggcatcatcgtttcc
tacaaggtgaaggtgaagctggtggtgtcacgaggaggcctgctgggagacctcgcctcc
agcgacgtggcagtggagctgcccttcacgctgatgcatcccaaacccagggaggagccg
gcacaccgggacattccagagaacgaagcgcccatagatacaaatctgatagagcttgat
acaaatgacgacgacattgtgtttgaggacttcgcccgccagcgacttaaaggcatgaag
gatgacaaggaggacgaggaggagcggacaaactccccgcagctcaacgacagcgggagc
ctacggatcgcccgatggccacaggacctattactgtccagctgtgccgtgttgtcactc
ttcatccagctgccagagctgctgtttcccgtgcagggcacagctggggggtgctggagg
caggggggctcgctctga

DBGET integrated database retrieval system