KEGG   Empidonax traillii (willow flycatcher): 114060027
Entry
114060027         CDS       T05887                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin-G2
  KO
K10146  cyclin G2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114060027 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114060027 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 114060027
NCBI-ProteinID: XP_027744966
LinkDB
Position
Unknown
AA seq 338 aa
MGSEALWLFKQLNLHLELEGRFQPREKGLSLIEAAAENENTLCPRQRNAKVEDLWSLTNF
FGFATETFVLAVNILDRFLALMKVKPKHLSCIGVCCIQLAARVVEEECNIPAAHEIIRIS
QCKCTVSDLKRMEKIISEKLHFEFKATTALTFLHLYHTIVLCHTSERKEVLNLDKLEAQL
KACNCRLVFSKAKPSVLALCLLTLEVQMLKSVELLEILLRVQKHSKISDGDLLYWRELVS
KCLADYSSPECCKPDHKKLVWIVSRRTAQNLQNSYYSVPELPTIPEGGCFNGSESEDSCE
DMSSGEESLSSSPPCDLEGTFFFELSPKPKWQTLSCGS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgggcagcgaggcgctgtggcttttcaaacagctgaacctccacctggagctggaggga
cggttccagccccgcgagaaggggctcagcctcatcgaggccgccgccgagaatgaaaac
actctgtgtccaagacaaaggaatgccaaggtggaagatctttggagcctgaccaacttc
tttggatttgcaaccgaaacatttgttttggctgtcaacatcctggacagattcttggct
cttatgaaggtgaagccaaagcacttgtcttgcattggagtttgctgcatccagctggcc
gcccgcgtggtggaggaggaatgcaacatccccgctgctcacgagatcatccgcatcagc
caatgtaaatgcactgtgtccgacctgaaacggatggaaaagatcatttcagaaaagttg
cactttgaatttaaagctactactgccttaaccttcttgcacttgtaccatactattgta
ctttgtcatacctcagaaaggaaagaagtattgaatctggacaagttggaagcacagctg
aaagcttgcaactgccgtctggtcttctctaaagcaaaaccatctgtcttggccttgtgc
cttctcactctggaagttcagatgttgaaatctgttgagctgctggagatcctcctgcgt
gttcagaagcattcaaagataagtgacggtgacctactttactggagggagctggtctcg
aaatgcctggcagactattcctccccggagtgctgcaagcctgaccacaagaagctggtt
tggattgtttccagacgaacagcccagaacctccagaacagctactacagcgtgcccgag
ttgccaacgattccggaggggggatgtttcaacgggagcgagagtgaagactcctgtgaa
gacatgagcagcggagaggaaagcctgagcagttctcctccctgtgacctggagggcacc
ttcttctttgaactcagccccaaacccaagtggcagactctcagctgtgggtcttag

KEGG   Empidonax traillii (willow flycatcher): 114067222
Entry
114067222         CDS       T05887                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114067222 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114067222
NCBI-ProteinID: XP_027758318
LinkDB
Position
Unknown
AA seq 295 aa
MIDTLASTEAEELLFQLSALLEQELRAQPKPAGLRLVEAAHDNGLRMTARLRDFEVKDLL
SLTQFFGFHTETFSLAVNYLDRFLSKMKVQPKHLGCVGLSCFYLAVKASEEERNVPLATD
LIRISQYRFTVSDMMRMEKIILEKLCWKVKATTAFHFLQLYHSLIHENLSCERRKYLNFE
RLETQLKACHCRIMFSKAKPSVLALSILALEIEEQKLLELTEALEFLQLHSKINNRDLTF
WKELVLKCLTEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPETSS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatcgacaccctggcgagcaccgaggccgaggagctcctgttccagctctcggcgctg
ctggagcaggagctgcgggctcagcccaagcccgccgggctcaggctggtcgaggctgct
cacgacaatggccttcggatgaccgcacggctgcgggacttcgaagtgaaagacctgctc
agcctaactcagttcttcggcttccacacggagacgttttccctggctgtgaattacttg
gatagattcttgtcaaaaatgaaggtgcagcctaaacacttgggctgtgttggactcagc
tgcttctacttggctgtgaaggcatcagaagaagaaagaaatgtgcccttggccactgac
ttaattcggataagccagtacaggttcactgtttctgatatgatgagaatggagaaaatc
atactggagaagctgtgttggaaagtgaaagctacaacagccttccactttctacagctg
taccattcactcattcatgagaatttaagctgtgaaagaagaaagtaccttaattttgag
agacttgagactcaactcaaggcctgtcactgcagaatcatgttttctaaagccaagcct
tctgtcttggcactgtctattctggcactagagatagaagaacaaaagctgctggagttg
acagaggcattggaatttctgcagttgcattccaagataaacaacagagatttgaccttc
tggaaggaactggtattaaagtgccttacagaatattcctcgagcaagtgttccaaacca
aatgtccagaaattaaagtggattgtgtccggacgtacagcacggcagctcaaacacagc
tactacagaataacacaccttcctaccattccagagaccagctcataa

DBGET integrated database retrieval system