KEGG   Empidonax traillii (willow flycatcher): 114060091
Entry
114060091         CDS       T05887                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114060091 (CCNE2)
   04114 Oocyte meiosis
    114060091 (CCNE2)
   04115 p53 signaling pathway
    114060091 (CCNE2)
   04218 Cellular senescence
    114060091 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114060091 (CCNE2)
   03036 Chromosome and associated proteins [BR:etl03036]
    114060091 (CCNE2)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    114060091 (CCNE2)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    114060091 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114060091
NCBI-ProteinID: XP_027745086
LinkDB
Position
Unknown
AA seq 405 aa
MSRRSSRLQAKQQQPLSCQEESPQELQTLEYLQTRKRRTAEQEIKKREDGKIAKKHQYEI
KSCWPPTITGGISPCIIIETPHKESVTTDFSRFKKYRFSNLFINPSPLPELNWGNSKDIW
LNILMKENRYAHCKHFTSLHSSLQPHMRSILLDWLLEVCEVYALHRETFYLAQDFFDRFM
LTQKNINKSMLQLIGITSLFIASKLEEIYAPKIQEFAYVTDGACSEDDIVRMELIMLKAL
KWELCPVTIVSWLNLYLQVDALKDVPKVLLPQYSQEKFIQIAQLLDLCILDVNSLDFQYR
TLAAAALCHYTSIEIVKKASGLDWENISECVEWMVPFVNVAKKYPVKLKNFKKVAAEDRH
NIQTHTNYLDMLEEVNSGAASTAPGQLSPVSTGGIITPPKSTEKK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttgcaagccaagcagcagcagccactgtcctgtcaagaa
gagtctccacaagaactgcaaacactagaatatctccagaccagaaaaaggagaacagca
gagcaggagattaagaaaagagaagatggaaaaattgctaaaaaacatcaatatgagatt
aagagttgttggccgcctacgataacaggaggcatctcgccttgcataattattgaaaca
cctcacaaagaatcagtgaccactgacttctcaaggttcaaaaagtacaggttcagtaac
ctcttcataaatccatcacctttgccagaactcaactggggaaactccaaagatatctgg
ctgaacatcctgatgaaggagaacagatatgctcactgcaaacacttcacatcactacat
tccagtctgcagcctcacatgagatcgatactgttggactggctcttggaggtgtgtgag
gtgtatgcactccaccgggaaaccttctacctagctcaagacttttttgatagattcatg
ttgacacagaagaacattaacaagagcatgcttcagctcataggaattacctcattattc
attgcctccaaacttgaggaaatctacgctcctaaaatacaggaattcgcttacgtcact
gatggtgcttgcagtgaagatgatattgtaagaatggaacttattatgttaaaggcttta
aaatgggaactctgtccagtcacaattgtctcctggctgaacctctatcttcaagtggat
gctttgaaggatgttcctaaagtgctgctacctcagtattctcaggaaaaattcatccag
atagctcagcttttggatctgtgtattctggatgtgaattctttggatttccagtacaga
acactagctgctgcagcgctctgccactatacctcaattgaaatagttaagaaagcttca
ggcttagattgggaaaacatttcagagtgtgtagaatggatggttccttttgtgaacgtg
gcaaaaaaatacccggtgaagcttaagaactttaagaaggttgcagcagaagatcgacat
aatatccagacacacacgaattacttggacatgctggaagaagtgaacagtggagcagcg
tccactgccccagggcagttatcgcccgtgtcgacaggtgggataataacccctcccaaa
agcacagagaagaaatga

KEGG   Empidonax traillii (willow flycatcher): 114063486
Entry
114063486         CDS       T05887                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114063486 (CCNE1)
   04114 Oocyte meiosis
    114063486 (CCNE1)
   04115 p53 signaling pathway
    114063486 (CCNE1)
   04218 Cellular senescence
    114063486 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114063486 (CCNE1)
   03036 Chromosome and associated proteins [BR:etl03036]
    114063486 (CCNE1)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    114063486 (CCNE1)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    114063486 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114063486
NCBI-ProteinID: XP_027751576
LinkDB
Position
Unknown
AA seq 413 aa
MRRQSSPSLGSDRAEEKGPARADGGADGAMRARKRKADVATFLQDPDEEIAKMELTRKKQ
CANQMSWNNIHENAHMLIPTPDKDDDPVSLNYSRFIHLSVVPTRATPLPALGWANRDDVW
KNMINKEETYVRDKLYMQRHPQLQPKMRAILLDWLMEVCEAYKLHRETFYLAQDFFDRFM
ATQQDVVKTLLQLIGVTSLFIAAKLEEIYPPKLHQFAYVTDGACTEDEIISMELIIMKAL
NWNLNPLTVVSWLNVYMQVAYLNELYEVMLPQYPQQIFVQITELLDLCVLDIGCLEYTYG
ILAASALYHFSSSELMQKVSGYEFCEIEECVKWMVPFAMALREVGSSKLKHFSGIAPEDL
HNIQTHINSFDLLDRAQAKQAILAEQNRTSPFPTGVLTPPQSSKKLSSGLQSI
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcgccggcagagctccccctctctcggcagtgaccgcgcggaggagaagggccccgcc
agggcggacggcggtgcggacggggccatgcgagcccgcaagaggaaagctgatgtggcc
acgttcttacaggatcccgatgaagaaattgccaaaatggagctgactagaaaaaagcag
tgtgcaaaccagatgtcctggaataacattcacgagaatgcccatatgctaattcctact
ccggataaagatgatgatccagttagccttaattactctcgctttatacatctgagtgtt
gttccaaccagagccaccccattaccagctctaggctgggcaaacagggacgacgtatgg
aaaaacatgataaacaaagaagagacctatgtgagagataagctttatatgcaaaggcac
cctcagctgcaacctaaaatgagggcaatccttctagactggctaatggaggtttgtgaa
gcctacaagcttcacagagaaactttttatttagcacaagatttctttgatcggtttatg
gcaacgcaacaggatgttgtaaaaacactattgcagcttattggtgtcacttctttattc
atagcagcaaagcttgaggaaatttacccacccaagttgcaccagtttgcctatgttaca
gatggagcctgtaccgaagatgaaatcatcagtatggagttgataattatgaaggctctt
aattggaacttaaatccattgacagttgtatcgtggctaaacgtttacatgcaagttgca
tatttaaatgagctttacgaggtaatgctgccacaatatcctcagcagatatttgtacaa
ataacagagctcttggatctctgtgtgctggatattggctgcttggaatatacatacgga
atacttgcagcttctgctttgtatcacttctcttcgtctgagctgatgcagaaggtttca
ggttatgaattctgtgagatagaggaatgtgtgaaatggatggtcccgtttgcgatggcc
ctaagggaagtaggaagctccaaactcaaacactttagtggaatagctcccgaagatttg
cacaatatacagacgcacataaacagctttgatttgctggacagagctcaagcaaaacaa
gccatattggctgagcaaaataggacttcacctttccctactggtgtacttacaccacca
caaagtagtaagaaactgtcttctggattacaatcaatatga

DBGET integrated database retrieval system