KEGG   Empidonax traillii (willow flycatcher): 114060935Help
Entry
114060935         CDS       T05887                                 

Gene name
MYBL2
Definition
(RefSeq) myb-related protein B
  KO
K21769  myb-related protein B
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114060935 (MYBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114060935 (MYBL2)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    114060935 (MYBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE Sigma70_r4_2 Atg29_N SbcD_C
Motif
Other DBs
NCBI-GeneID: 114060935
NCBI-ProteinID: XP_027746630
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MARRTRGEDQDELRYQDTELDVPEQRDSRCKVKWTQEEDEQLKMLVSHYGQNDWKFLASH
FPNRSDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTI
KRKVDTGGFLNENKESKSLYLLVEVDNKERQSQTTAESQNVLPNWPVDISEIKEEDVSDE
EVTGVQELPSELPVAELAEQNVEGTPEEAALPEDATSFVESPYKWVVEAANYLYPSCVPA
FNEALDMIESDPDGGWCDLTQFDLPEEPSVGGSSSSNSPVRQTPREAVPSLPSMTEYRLD
GHTISDLSRSSKGELIPISPHAEGSFGTPPSVLKRQKKRKISLSPVTENVTSTSLSFLDS
CNSMTPKGTPVKTLPFSPSQFLNFWTKQDTLELENPSLTSTPVCSQKVIVTTPLHRDKTP
LPQKNLAFVTPDQTYVVDNTPHTPTPFKNALEKYGPIRPLPQTPHLEEDLKEVLRSEAGI
ELIIEDEVKPEKQKRKQGLRRSPIKKVRKSLALDIVDEDITQNLPALPKTVCFKRAQPVN
FLSRSLNLSSSSRKNDSGLLNRGFMQVQPEKMSYRKMPNHFRPPAPMTRAWKAVACGGTQ
DQLFMQEKARQFLGTLKQSHTSRTLILS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccgcacccgcggtgaggaccaggatgaactgcgctaccaggataccgaattg
gatgtgccagagcagcgggatagcaggtgcaaagtcaagtggacccaagaagaggatgag
cagctgaagatgttagtaagccactatgggcagaatgactggaaattcctggccagtcac
tttcctaaccgcagtgatcagcagtgtcagtacaggtggctgagagtgttgaatccagac
ctggttaagggcccttggaccaaagaagaggaccaaaaggtaattgaactggttaaaaag
tatggcaccaaacagtggaccctgatagccaagcacctgaaagggcgtttagggaagcag
tgccgggaacgctggcataaccacctgaaccctgaagtgaagaagtcctcttggacagag
gaggaggatcgtataatttttgaggcccacaaggtcctggggaatcgctgggcggaaatt
gccaagctgctgcctgggaggaccgacaatgctgtgaagaatcactggaactccaccatc
aagcggaaggtggacacgggaggctttctcaatgaaaataaggagtccaagtcactgtac
ttgcttgtggaggtggataacaaggagagacaaagtcaaacaacagctgagagccagaat
gttctgccgaactggccagtggatatctctgagataaaggaagaagatgtcagtgatgag
gaggtgacgggtgtacaggagttgccctcggagctgccagtggcagaactggcagagcag
aacgtggaggggactccagaagaggcagcactgcctgaggatgccacttcatttgtcgaa
tcaccctacaaatgggttgttgaagctgccaactatttgtacccaagttgtgtgccagcc
ttcaatgaagctctggacatgattgaatctgacccagacggtggctggtgtgacctgacc
cagtttgacctgcctgaggaaccttctgttggtggcagcagcagtagcaacagccccgtg
aggcaaacgccaagggaggccgtgccatccctgcccagcatgaccgagtaccgcctggat
ggccacaccatctctgacctgagcaggagcagcaagggagagctaatccccatctccccc
catgctgaggggagctttggcaccccgccctcagtgctgaagaggcagaagaagaggaag
atctccctctcccctgtcacagagaacgtcaccagcaccagcctgtccttcctggactcc
tgcaacagcatgacgcccaagggcacccctgtaaagacactgcctttctctccatctcag
ttcctaaacttttggaccaaacaggatacactagaactggagaacccatccctgacctcc
acacctgtgtgcagccagaaagtgattgtcaccaccccactgcacagagacaagacccct
ctgccccagaagaacttagcgtttgtcacaccagatcagacatatgtggtggacaacaca
cctcatactcccacgcctttcaaaaatgccctggagaaatatggaccaattagacctctg
ccccagactcctcacctggaagaagacttgaaagaggtgctccgaagtgaagctggcatc
gaactcatcatagaggatgaggtgaagcctgagaaacagaaaaggaaacaagggttgcgc
aggagtcccatcaagaaggtccggaagtctctagccctggatattgtggatgaagatatt
acacaaaatctgcctgccctccccaagactgtgtgtttcaaaagagcccagcctgtgaat
ttcctgtcaaggtccctgaacctttcctcctcgagcaggaagaatgacagtggtttgctc
aacagaggcttcatgcaagtgcagccagagaaaatgtcctacaggaaaatgccgaaccat
ttcaggccaccagcaccaatgaccagggcttggaaagcagtggcctgtggtggaacccaa
gaccaactcttcatgcaggagaaagctcgacagtttttgggcacgctgaaacagagtcat
acatcaaggaccttaatcttatcatga

DBGET integrated database retrieval system