KEGG   Empidonax traillii (willow flycatcher): 114061072
Entry
114061072         CDS       T05887                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114061072 (GADD45A)
   04068 FoxO signaling pathway
    114061072 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114061072 (GADD45A)
   04210 Apoptosis
    114061072 (GADD45A)
   04115 p53 signaling pathway
    114061072 (GADD45A)
   04218 Cellular senescence
    114061072 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114061072 (GADD45A)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     114061072 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     114061072 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 114061072
NCBI-ProteinID: XP_027746905
LinkDB
Position
Unknown
AA seq 157 aa
MTLEELPGERRAAGRMEQAGDALEEVLSKALSQRSLTLGVYEAAKLLNVDPDNVVLCLLA
AEEEEAGDAALQIHFTLLRAFCCENDINILRVSNPARLAQLLLPAAGPDPPADLHCVLVT
NPQASQWKDPALSQLMCFCRESRYLDQWVPVINLPER
NT seq 474 nt   +upstreamnt  +downstreamnt
atgactctggaggagctgcccggggagcgccgcgccgccgggaggatggagcaggcgggg
gacgcgctggaggaggtgctgagcaaggcgctgagccagcggagcctcaccctcggcgtc
tacgaagcggccaagctgctcaacgtggaccccgataacgtggtgctgtgcctgctggcg
gccgaggaggaggaggcgggggacgcggcgctgcagatccacttcacgctgctgcgggcc
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccggcgcgcctggcgcag
ctgttgctgcccgccgcgggccccgacccgcccgccgacctgcactgcgtgctcgtcacg
aacccccaggcctcgcaatggaaggatccagcgctgagtcagctgatgtgtttctgccgg
gagagccggtacctggatcagtgggtgccggtgatcaacctcccggagcggtga

KEGG   Empidonax traillii (willow flycatcher): 114061921
Entry
114061921         CDS       T05887                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114061921 (GADD45G)
   04068 FoxO signaling pathway
    114061921 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114061921 (GADD45G)
   04210 Apoptosis
    114061921 (GADD45G)
   04115 p53 signaling pathway
    114061921 (GADD45G)
   04218 Cellular senescence
    114061921 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114061921 (GADD45G)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     114061921 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     114061921 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 114061921
NCBI-ProteinID: XP_027748693
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIHGQQPAPVGHDWMQGAGTALHDLLVSAQRRGCLTAGVYESAKLMNVDPDNVAFC
VLAADQEDEGDIALQIHFTLIQAFCCENDIDIVRVNDVAKLAAIVGPSEESGEPRDLHCI
LITNPNEEGWKDPALEKLNLFCEESRNVNDWVPTITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggagatccacggacagcagcctgcgcccgtgggccacgactggatgcag
ggagccggcacggccctccacgacctgctggtgtcggcacagcgccgaggctgcctcacc
gccggcgtctacgagtcggccaagctgatgaatgtcgaccccgacaacgtcgcgttctgc
gtgctggccgcggaccaggaggacgagggggacatcgctctgcagatccacttcaccctg
atccaagccttctgctgcgagaacgacatcgacatcgtgcgggtgaacgacgtggccaag
ctggcggccatcgtggggcccagcgaggagtccggggagccgcgggacctgcactgcatc
ctcatcacgaacccgaatgaagaaggctggaaggacccagctcttgaaaagctgaacttg
ttttgtgaagagagccgaaatgtcaatgactgggtgccaactatcaccctgcccgagtga

KEGG   Empidonax traillii (willow flycatcher): 114072120
Entry
114072120         CDS       T05887                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114072120
   04068 FoxO signaling pathway
    114072120
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114072120
   04210 Apoptosis
    114072120
   04115 p53 signaling pathway
    114072120
   04218 Cellular senescence
    114072120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114072120
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     114072120
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     114072120
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 114072120
NCBI-ProteinID: XP_027765840
LinkDB
Position
Unknown
AA seq 115 aa
RAPHSDPDSVVLCVLATDEEDEGDIALQIHFTLIQAFCCDNDIHILRVSGMQRLAAILGG
GDPEPGAEPRDLHCLLVTNPHTDAWKGQGLAEVASYCAESRDRNQWVPYVCLQER
NT seq 348 nt   +upstreamnt  +downstreamnt
cgtgccccccacagcgaccccgacagcgtcgtgctgtgcgttctggccaccgacgaggag
gacgaaggcgacatcgccctgcagatccacttcaccctcatccaggcgttctgctgcgac
aacgacatccacatcctgcgcgtgtccgggatgcagcgcctcgccgccatcctcggcggg
ggcgaccccgagccgggggccgagccccgggacctgcactgcctcctggtcacgaacccg
cacacggacgcctggaagggccaggggctggcggaggtggcgagttactgcgccgagagc
cgcgacaggaaccagtgggtgccctacgtgtgtctgcaggagcgctga

DBGET integrated database retrieval system