KEGG   Empidonax traillii (willow flycatcher): 114061463
Entry
114061463         CDS       T05887                                 

Gene name
EVC2
Definition
(RefSeq) limbin isoform X1
  KO
K19608  ellis van creveld syndrome protein 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114061463 (EVC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114061463 (EVC2)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    114061463 (EVC2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 114061463
NCBI-ProteinID: XP_027747770
LinkDB
Position
Unknown
AA seq 1275 aa
MRWPLAGLLLALLPGGPSAPPQPLAAAAGRGPRREPRGRTAVVKDNLWLQKEMGCLGMAG
PFSLAIWANKAPHQLLTSAASDNQWSHSLFALVPSWTKKILFKRESDLDHQLPEDVSNMS
VSSEFGITLQKCGMVDVEHDPQTAYITLVINNTNTLLSTNITDLILLDNITGLHIQKTSG
NKTTDGIQIYRKRFLQGGEHFAINYSALLDAKEMWDGRVLTLPAKLTFRSSSQNKTHLVS
LTASFTITEEEKTKIMYSHAITASGFFISFFISLVLTCAVFLIIYRTQILKWSFCSKNQE
IQHELSQNHKLEHSQFNSGDLFSEDIIMNDQIIDILFFEEPGNMLQALEDLDVASLTRAD
ADLEAQRTQICKEVIGMMLKNMVLSHNLFPHVEKKISSVFKKRFLAMEKEIQEEYERKMV
ALTAECNLETRKKMEAQCQKARAANEEAEELMKKINEKPAVEYRSLLDRFHRLEQDHLKR
FLLVKQEEYFAKAYRQLAVTQRKELHTIFFAQITNATLKGELKLEAAKTLVEGYSKIQGD
IEELMDFLQASKKYHLNRRFSYREYLISKIQLRDSHVSALINAAATQISSLLNKMERAGH
LPESHLRMLLDRAETEINFVKQKFDHDLKQEKQKLQQKLITKRRREMLQKKEHQKEQLSL
GDPFKTTNDIIHYLRHWKNLLSDNNIEFEELIEKLDNEASEELKELLFSLTEKAIEEFKR
VQCGVFVQELVKLNVPKPFLLEAMEEHKKEMAVKREQLEREEHDKSTAAEELLQLTRQKL
SQELETGISEQKKLRNWEQSVFMQLLSLPLSLSEEELLRMRQELHCCFSQVDSGLAWPKI
RTRTLLQTFEMEQRDTEMLKVDQNLAMTNKQQHSKMGKTGSRNRNKLEILKKSLQDKILI
YEDLVKDENLNKIKNELQLEKECHLRDLENNLGEYIASLAFQKTVKKSKMLELYTAIINV
QALLFEQLSVSKTLSKLEYVQILEAHNPEIEELDRKLEYEMLHKDSAQQHLSRQRWILDG
LGLSSEAVETNAERHMTVLLRQAMNKCRQFINLYQQSLRDEQWNCVMLENLLENIEMDAF
LAIYSQELRLAGYLAKLTRVPMGMLHRVLNWLLPSSSQSEVLSVLDSISKYSDGGVDSDS
NADESGNCKKRKNQELWQAWEKKVRQDLINRSLEKIPPLKKRKDSLIKKKQCALLEKTAF
IHLGCSPTHPPMEQSDPPVSVNTATNEAIELLETGEKIFLFREPSDPVPTLHNSPRKKKK
NFLNSKKAARANVDL
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgcggtggccgctggccgggctgctgctggcgctgctccccggcggcccctccgcgccc
ccccagcccctggcggcggccgccgggcggggcccgcgccgggaaccccgcggccggacg
gcggttgttaaagataatctgtggcttcagaaagaaatgggatgcttaggaatggcaggg
cccttctctctggccatttgggcaaacaaagcacctcaccagctcttgacttctgcagcc
tcggacaaccagtggagccattcgctgtttgccttggtaccctcgtggacaaagaagatt
ttgttcaaacgggagtctgatcttgaccaccagctgcctgaagatgtttccaatatgtca
gtgtcttctgaatttggaataacccttcagaagtgtggtatggtggatgttgagcacgac
cctcaaactgcatacattacacttgtgattaataacaccaacacgttgctctcaacaaac
attacagatcttatcctcctggacaacatcactggtctacacattcaaaaaactagtggg
aataagaccacagatggcatacaaatttacaggaaaagattcttgcaaggtggagaacac
tttgcaatcaactactctgcacttcttgatgcaaaagaaatgtgggatggcagggtcttg
acactgcctgcaaagctaactttcaggagttcatcacagaataaaacacatctcgtatcg
ttgacagcatcgttcaccataactgaagaggaaaagaccaagattatgtacagccacgcc
atcactgcttcagggttcttcatctcttttttcatttcccttgtattgacatgtgctgtt
ttcctcataatttaccgaacccaaatattaaaatggagtttctgtagtaaaaaccaggag
atacagcatgaactcagccaaaatcacaaactggagcattctcagtttaattcaggtgat
ctcttcagtgaagatataattatgaatgaccaaatcatcgatattctattctttgaagaa
cctggcaatatgcttcaggctttagaagatttggatgttgccagcctgacacgggcagat
gctgatctggaggcacaacgaacacagatatgtaaagaagtgattggtatgatgttgaag
aacatggtcttaagtcacaacctctttcctcacgtggagaagaagataagttctgttttc
aaaaagcggtttcttgcaatggagaaagagattcaagaggagtatgaaaggaagatggtg
gctttaacagctgaatgtaatctggaaacgaggaagaaaatggaagctcagtgccagaaa
gcaagagctgcaaatgaagaggctgaggaactaatgaagaaaattaatgaaaagcctgct
gtagaatacagaagtcttctggatagatttcacagactggagcaggaccacctgaagagg
ttccttctggtaaaacaggaggaatattttgcaaaggcttatagacagctggctgttacc
cagagaaaggagctccatacaatcttctttgcacagataacaaatgcaactttaaaggga
gaactgaagttggaagcagctaaaacattagtggaaggttactctaaaatacagggagat
attgaagagctaatggattttttgcaagctagcaagaaatatcatctgaatagaagattt
tcttaccgagagtatcttataagtaagatacagttaagggattctcatgtctctgctctt
ataaatgcagcagcaacccagatatcaagtctccttaataagatggaaagagcaggtcac
ctacctgaaagtcatttgagaatgctgctggaccgagctgagactgaaattaattttgtt
aaacagaaatttgatcatgatttaaaacaagaaaagcaaaagcttcagcagaaactcatt
accaagcggaggcgggaaatgctgcaaaagaaagagcatcagaaggagcagctgtcactt
ggagaccccttcaaaactactaatgacatcattcactacctgagacactggaaaaatctt
ctgagtgataacaacattgaatttgaagaacttattgaaaagcttgacaatgaagccagt
gaagagctgaaagagcttctatttagcctaacagaaaaagccattgaagagtttaaacgt
gttcagtgtggagtgtttgtgcaagaattggtcaaactcaacgtgccaaagcctttcctg
ctagaagctatggaggagcataaaaaagagatggctgttaaacgtgaacagcttgaaagg
gaagaacatgacaagagcacggctgctgaagagctgcttcagctcaccaggcagaagcta
agccaagaactggaaacaggcatttcggaacaaaaaaaattaaggaactgggaacaatca
gtattcatgcagcttctaagtttacccctctcactatcggaggaggaattgcttagaatg
aggcaagagctgcactgctgcttctctcaggtggacagcggcttggcttggcccaagata
agaacaagaaccttgcttcagacttttgagatggagcagagggacacagaaatgctgaaa
gtcgatcagaatttagcaatgaccaataaacagcagcattctaaaatgggaaaaacagga
tccaggaatagaaataagttagaaattctgaagaaatctttacaggacaaaattttaatt
tatgaagacttggtgaaagatgaaaatttgaataagattaagaatgagttgcagcttgaa
aaagagtgtcacctgcgtgatctggaaaataaccttggagagtatattgcttctttagcc
tttcaaaagactgttaaaaaatccaaaatgctggagctttatactgctatcataaatgtg
caagctttgctctttgaacaactgagcgtatcaaaaaccctgtcaaaattggagtatgtt
caaattttagaagcacataatcctgagattgaagaacttgacaggaagctggagtatgag
atgttgcataaggactcagcgcaacagcatctgagtaggcagaggtggattctggatggt
ttgggactttcaagtgaagctgtggaaacaaatgcagaaagacacatgacagttttgcta
agacaggccatgaataagtgtaggcaatttataaatctgtaccagcaaagcttgagagat
gagcaatggaattgcgtgatgcttgaaaatctcctggaaaatatagagatggatgcattt
ttggcaatttatagtcaggagctccgtctggcaggttatttagctaaactgacgagggtg
ccaatggggatgttgcacagggtcctgaactggttgctgccctccagctctcaaagcgag
gttctttctgtcctcgattccatcagtaaatactcagatggtggtgttgatagtgacagt
aatgcagatgagtctggcaactgtaagaaaaggaagaaccaagagttgtggcaagcatgg
gagaaaaaagtaaggcaagatctgataaacagaagtttagagaagatccctcctctaaaa
aagaggaaagacagcttgataaagaagaagcaatgtgctctcttggaaaaaacagcattc
attcatcttggatgttcacctacacatcctcctatggaacagtctgatccacctgtttct
gtgaacactgcaactaatgaagccatagagttgttagagacaggggagaagatatttttg
tttcgtgagccaagtgatccagtacctactttgcataattctccaaggaaaaagaaaaag
aactttcttaattctaaaaaggctgctcgtgcaaacgtggacttatga

KEGG   Empidonax traillii (willow flycatcher): 114061464
Entry
114061464         CDS       T05887                                 

Gene name
EVC
Definition
(RefSeq) ellis-van Creveld syndrome protein isoform X1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114061464 (EVC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114061464 (EVC)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    114061464 (EVC)
SSDB
Motif
Pfam: BAG6 Tfb5
Other DBs
NCBI-GeneID: 114061464
NCBI-ProteinID: XP_027747774
LinkDB
Position
Unknown
AA seq 984 aa
MAAAGGCLRAVGLQFWAGWLPALPALLAPAVLLGLLLGAATAALLCRCALGPRRRAQKDD
SQRLLESFSSDEKEHTFTKNKAEPYTSQEEMVLEEGDSPLDSNITAFALKAKVIYPINQK
FRPLADGSSNPSLHENPKQAVLPNQVVETSTSGSLGSLSQGDKEDCSSSTTIHSTTSDDR
FQARAFLKVTSFPEVLTCESFDVKLCLCSLILKDLMQLDTELRKEKYVMFIQVLKIYLTD
FYRKKKITDDLFKKILLIQENDFEELQKQLDSRLQNTEMSGARNSEYQTLEDLERKEREY
SEHVIDNMEAFWKQTDKAQQAFLDQSKCSSAKATKIMVDLTEKMIAVESLLSESQDLRTM
DIQERLFSWELMVKMIDSLKSYIPEECKGRLIIVSNILDHLTVKKNLSVRQKEELLTDLH
KAFWEQLAHFSNECTQQSKDLILKRLECRAKKKEEFKHRQEAEQESLLRKTFLNEDVHNF
LKAYHELIEKHQEAQWELEEEDDCESTEAVANLYKELYSKACHALAELVTELFLQTLPMV
TGLSVRECELLKEEWQENSVPQMEKWETHRQKRWKLFQEQLLQEKELWTMEYALSAVMQK
HLSEKQEKIIQGVVSRLGCLSDESVNYILQKHRLLLHSVLRRLTLRRAGMAVLAHMRLSR
KKSLLQELSEQHTLQKGSSLCQDEDQWQLQKAVESHIREEEEKLEEETQETNLEFHQQLV
TEIQEALQFLQQHMEQVIGQTLLQHAQREAGKKSSDDGQDFKERLVEAAVESVYGTSNNI
NRLVQNYYQQLGKITEGYEGKKLQQLKSLQAERNEKIRLKKKQENELALKEKHTKDFLNV
SSAVHQRIVLQQKKVLSQFELQQQIRLESLKQKLLALHHLETELENQLREAEQDFVSELA
VLTRVPMTVKKKPSKRSKTAGEKTKSKRQPFHSPESAEKDDSHGNIQEPHGLTSGSCREM
LQSPREGEMEPRKNSNILKEKSSG
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcggcggccgggggctgcctgcgggccgtggggctgcagttctgggcgggctggctg
ccggcgctgcccgccctgctggcccccgccgtgctgctggggctgctgttgggcgccgcc
accgccgccctgctctgccgctgcgcgctcgggccgcgccggcgggcacagaaagatgat
tcccagagacttctggaaagcttcagctctgatgaaaaagaacacacattcacaaaaaat
aaagcagaaccctatacatcacaagaggaaatggtcctggaggaaggtgactctcctctg
gacagtaacatcacggcatttgcattaaaggcaaaagtgatctatcccatcaatcagaaa
tttaggcctttggcagatggctcatccaatccatctttgcatgagaatccaaagcaggca
gttctgcctaatcaggttgtggagacatccacatcaggcagcctgggatccctgagccag
ggagacaaagaggactgtagttcctccacaacaatacattccacaacaagcgatgacaga
tttcaggctcgagccttccttaaggtgaccagcttccctgaagtgctgacatgtgagagt
tttgatgttaagctctgcctttgcagtctaattttaaaagatctcatgcagcttgatact
gaactcagaaaagaaaaatatgtgatgtttattcaggttctcaaaatatacctcacagac
ttttatcgtaagaagaagattactgatgatttgttcaagaagatccttttaattcaagag
aatgattttgaagagttacagaaacaacttgactcgagactccagaatactgagatgtca
ggagcgcgtaattcagagtaccagactctagaagacttagaaaggaaggaaagggaatat
tctgagcacgtaatagataatatggaagctttctggaagcagactgacaaagcccagcag
gcttttttggaccaatcaaaatgttcaagtgccaaagcaacaaagataatggtggatctg
accgagaagatgattgcagtggaaagtttgttaagtgaatctcaagatttgcggacaatg
gacattcaggaaaggttattcagctgggagcttatggtgaaaatgatcgattcccttaag
tcctatataccagaagagtgcaagggtagattaattattgtatcaaatattctggaccat
ttaactgtaaagaagaatctttcagtccgacaaaaggaagaacttctaacagatctgcac
aaggccttctgggaacagctggcacatttcagtaatgaatgtacgcagcaaagtaaagac
ctgatcttgaaacgactggagtgccgcgcaaagaagaaggaagagtttaaacacagacag
gaagctgaacaagagagtctccttaggaaaacgtttcttaatgaagatgttcataatttt
ctcaaggcttaccatgagctgatagagaaacatcaggaagcacagtgggaactggaggag
gaggatgactgcgagagcacagaggctgttgccaatctctacaaggagctgtactctaaa
gcttgccatgctttagctgagttggtgactgagctgtttcttcagaccctaccaatggtg
accggcctctctgtaagggaatgtgagcttctgaaagaggaatggcaggagaattcggtc
cctcagatggagaaatgggaaacccaccgccagaaacgctggaagcttttccaggaacag
ctattgcaagaaaaagaactatggacaatggaatacgctctgtctgctgtgatgcaaaag
cacctgtctgagaaacaagagaagataattcaaggtgtcgtaagcagactgggatgcctc
agtgatgagtctgttaactacatattgcaaaaacatcggcttctgctgcattcagtgctc
agaaggttaactctccgaagagctggaatggcagtcctggcccacatgaggctgtccaga
aagaagagcctgcttcaggagctgagtgagcaacataccctgcaaaagggatcctccctg
tgccaagatgaggaccagtggcagttacagaaggcagtggagtcccacattcgggaagag
gaggagaaactcgaggaagaaacacaggaaaccaatttagaatttcaccagcagctagtc
acagaaatccaagaagctcttcagtttcttcagcagcacatggagcaggtgattgggcag
acactgctgcagcatgcccagcgggaagctggaaaaaagagttcagatgatgggcaggac
ttcaaggaaaggctggtggaagctgctgttgaaagtgtgtatgggaccagcaataatatc
aatagactggtgcaaaactactaccagcaattaggaaaaatcacagagggctatgaaggg
aaaaagcttcaacagctgaaatccttacaagcagaaagaaatgagaagatcagacttaag
aagaaacaagagaatgaactggcattgaaagaaaaacacaccaaagacttcctgaacgtg
tcatctgcagtccatcaaaggatagtgctgcagcaaaagaaggttttgtctcagtttgaa
ctgcagcagcaaattcgtctggagtctctgaaacagaagctgctggcattgcatcacctg
gaaaccgagctggagaatcagctaagggaagcagagcaggactttgtgagcgagttggct
gtgctgaccagagttccaatgactgtgaagaagaagccttccaaaaggagcaagacagca
ggggaaaaaacgaagtccaaaagacagcccttccactcacctgaatcagcagaaaaagat
gattctcatggaaatattcaagagccccatggactgacttctggctcatgcagagagatg
ttgcagagcccacgtgaaggggagatggaaccaaggaaaaactcaaatatcttaaaagaa
aaaagcagcgggtag

DBGET integrated database retrieval system