KEGG   Empidonax traillii (willow flycatcher): 114061540
Entry
114061540         CDS       T05887                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114061540 (CHEK2)
   04115 p53 signaling pathway
    114061540 (CHEK2)
   04218 Cellular senescence
    114061540 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114061540 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etl03400]
    114061540 (CHEK2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114061540 (CHEK2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   114061540 (CHEK2)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    114061540 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like YrbL-PhoP_reg Pkinase_fungal Kdo Pox_ser-thr_kin APH
Other DBs
NCBI-GeneID: 114061540
NCBI-ProteinID: XP_027747906
LinkDB
Position
Unknown
AA seq 551 aa
MDLNINSTVCECLLVLLYCSNCVFFNILFEANMSRETESEVQQTQVTQSSQSSSSSGSQS
TSQSSSSSGTLSSLDTVPTQELPSIPEDQEPEELVPQPWGRLFALAAGFSNCDCVNEEYW
FGRDKSCDYSFSKLGLYETGFYENYSKKHFRIFREMGPKNSYVAYIEDHSANGTFVNKEL
VGKGKRLPLIHNSEIALSLQTNKVFVFSDLTVDDQMTFPRELREKYIMSKTLGSGACGEV
KLAFEKSTCNKVAVKIINKRKFAASGLREANPAFNIDTEIEILKKIDHPCLIKIKNFFEA
EDYYIVLELMEGGELYDRVSRPVKMKEATCKLYFYQMLLAVKYLHDNGIIHRDLKPENVL
LSSSEETCLIKITDFGQSKILGEASLMKTLCGTPMYLAPEVLNSLGTAGYSRAVDCWSLG
VILFVCLCGYPPFSEQNTQLSLEEQITRGKYTFIAREWKHVSDTALDLVKKLLVVDPRKR
LTTEEALKHPWLQDEDMKSTFQQLLAQTHASMNPPQTSKMPTTTRKRHHENEEESGPSKR
TAPSTSFQKMR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacttgaacattaatagtacagtgtgtgagtgcttactagttttactttactgtagt
aactgtgttttttttaacatcctctttgaagccaatatgtcccgagagactgaaagtgaa
gtacagcagactcaagttacccagtcgtcacagagttcttcttccagtgggtcacagagt
actagtcagtcttcctcaagttctgggaccctcagttctttggacactgttcccactcag
gagcttccatcgatccctgaggaccaggaaccggaagagctggttcctcagccgtggggt
cgactctttgcacttgcagcaggtttcagcaattgtgactgtgtgaatgaggaatactgg
tttgggagagacaaaagctgtgattacagtttttctaagctaggattgtatgagactggc
ttctatgaaaactatagcaagaagcatttccgaattttcagggaaatgggtcccaaaaat
tcctatgttgcctatattgaagaccatagtgcaaatggaacatttgtgaataaagagctt
gttggaaaagggaagaggcttccactgattcacaactccgaaattgcactgtctctacag
accaataaggtgtttgtgttttctgatcttacggtggatgatcagatgacgtttcctaga
gaattgagagagaaatatatcatgtcaaagactttgggaagtggcgcctgtggagaagtc
aaactggcatttgagaagagcacttgtaacaaagtggccgtgaagatcatcaataaacgg
aagtttgcggcaagtggcctgagagaggcaaacccagcttttaatatcgatacagaaatt
gaaattttgaagaaaatagatcacccttgcctaatcaagatcaaaaacttttttgaagca
gaggattactacattgttttggaactgatggaaggaggagaattgtatgacagagtgtca
aggccagtcaagatgaaagaagctacctgcaagttgtatttttatcagatgctgctggca
gtaaagtatcttcatgacaatggaattatacaccgagacctaaagccagaaaatgtgcta
ctttcatcttctgaagagacgtgtcttataaagattacagattttggacaatccaagatt
cttggagaagcttctcttatgaaaacattatgtggtactcccatgtatcttgctcctgag
gttctaaattcacttgggactgctggatacagccgagctgtggactgctggagtttagga
gttattctttttgtatgcttgtgtggatatccaccattcagtgagcaaaatactcaactc
tctctggaagaacaaatcactcgtggaaaatacacgttcattgcaagagaatggaagcac
gtgtcagacacggctctggatcttgtgaagaagctgttggttgtggacccacgcaaacgt
cttaccacagaggaagccttaaagcatccttggcttcaggatgaggatatgaagagtaca
tttcaacagctacttgctcagacacatgccagtatgaatccaccacaaacatcaaaaatg
ccaaccacaacgagaaagcgtcaccatgaaaatgaggaagaatctggcccttctaagcga
actgctccttctacatcgtttcagaaaatgagatga

DBGET integrated database retrieval system