KEGG   Empidonax traillii (willow flycatcher): 114061633
Entry
114061633         CDS       T05887                                 

Gene name
CD82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114061633 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114061633 (CD82)
   04090 CD molecules [BR:etl04090]
    114061633 (CD82)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114061633 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   114061633 (CD82)
  Exosomal proteins of colorectal cancer cells
   114061633 (CD82)
CD molecules [BR:etl04090]
 Proteins
  114061633 (CD82)
SSDB
Motif
Pfam: Tetraspanin DUF2981
Other DBs
NCBI-GeneID: 114061633
NCBI-ProteinID: XP_027748097
LinkDB
Position
Unknown
AA seq 265 aa
MGSGCLKVTKYFLFLFNLLFLILGAVILGFGIWILADKTSFIAVLQMSSPSLKTGAYILI
GVGALTMLMGFLGCLGAVNEIRCLLGLYFTCLMIILITQVAAGLVIYFQKETLKEELSRI
VKDLIENYNPLNEDKKNLQEVWDYVQIQITCCGWTGAKDWEDNEIIINKSMTEYPCSCSN
RTEDLEEGRGFCRLDEPVNGTATYTDWPVHGQGCMDGVEQWLKDNLGVILGVCTGVAVIE
LLGMILSISLCKNIHSEDYTKVPKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atggggtctggctgcctaaaagtcaccaagtacttcctcttcctcttcaatctcctgttc
cttatcctgggggctgtcatcctggggtttggaatatggattctggccgacaaaaccagt
ttcattgcggttctacaaatgtcatctccctccctgaagactggtgcatacattctcatc
ggtgttggggcgctcaccatgctcatggggttcctgggctgtcttggagcagtcaatgaa
attcgatgtctcttgggtctgtacttcacctgcctgatgataatcctcataactcaggtt
gctgctggattggtcatctacttccagaaagaaacgctgaaagaagagttgtcccgcata
gttaaagatctgattgaaaattataaccctttgaatgaagataagaagaacttgcaagaa
gtatgggactatgtgcaaatacagatcacctgctgtggttggactggagcaaaagactgg
gaagataatgagattattatcaacaaaagcatgacggagtatccctgctcctgctccaat
agaaccgaggacttagaggaaggaagaggtttctgtcgtctggatgagcctgtcaatggc
actgcaacctatactgactggcctgttcatgggcagggatgcatggatggtgtagagcag
tggttgaaggacaaccttggtgtcattcttggggtttgcactggtgttgctgttatagag
ctgctggggatgatactgtccatttcgctttgcaagaacatacacagcgaagactacacc
aaagtgcccaagtcttga

DBGET integrated database retrieval system