KEGG   Empidonax traillii (willow flycatcher): 114061786
Entry
114061786         CDS       T05887                                 

Gene name
IPO13
Definition
(RefSeq) importin-13 isoform X1
Organism
etl  Empidonax traillii (willow flycatcher)
SSDB
Motif
Pfam: Importin_rep_2 Xpo1 Importin_rep_3 Importin_rep IBN_N SLED
Other DBs
NCBI-GeneID: 114061786
NCBI-ProteinID: XP_027748379
LinkDB
Position
Unknown
AA seq 961 aa
MERRAEAPPPPPPQGLDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSW
LLLHMDKVPEIQYFGASALHIKISRYWNDIPADQYESLKSQLFTHITRFASGSKIVLTRL
CVALASLALSMMPDAWPCAVADMVRMFQAEDSNVDGRARCLALLELLTVLPEEFQTSRLP
QYRKGQVRSVLAQECGSVFPLLEQLLQQQDSPGFIKQKVLKCFSSWVQLEIPLMDCENLI
QAAFTSLQDPELFDTAVEAVVNAISQPDAQRYVNTLLKLIPPVLGLQEQLRQAVQSGDME
TSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLTLTF
WYTLQDDILSFEPDKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQFRIY
RVDISDTLMYVYEMLGAELLSSLYDKLGRLLTNTEQPSTWQHTEALLYGFQSIAETIDVN
YSDVVPGLIGLIPRISISNVQLADTVMFTIGSLSEWLADHPVMINNVLPLVLQALGNPEL
SISSVSTLKKICRECKYDLPPYAANIVAVSQEVLMKQIHKTSQCMWLMQALGFLLSALQV
EEILKNLHSLITPYIQQLEKLADETPNPSNRLAIIHILGLLSNLFTTLDISHHDDDHEST
EVKKLPVQQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVESVCAIFEKSVKTLLDDFAPM
VPQLCEMLGQMYSTIPQVSAIELTRQLVHIFAHEPAHFPPIKALFLLVTSVTLTLFQQGP
RDHPDIVDSFMQLLAQALKRKPDLFLCSNLDVKAVFQCGVLSLKFPEAPTVKSSCGFFTE
LLPRCGEIAPVGQVVQENGKVLLQAVLEGIGGQASRSLMDHFAEILFALNKHCFSLLSVW
IKEAMQQDGFPSARVTPEQKENFSQQILSRERVNKRRVKEMVKEFTLLCRGLHGTEYTAD
Y
NT seq 2886 nt   +upstreamnt  +downstreamnt
atggagcggagggcggaggcgccgccgccgccgccgccgcagggcctcgacttcaccgtg
gagaacgtggagaaggctctccatcagctgtattatgacccaaacatcgagaacaagaac
ttggctcagaaatggcttatgcaggcacaggtgtccccccaggcgtggcacttcagctgg
ctgctcctccacatggacaaggtgcccgagatccagtactttggtgccagcgctctccac
atcaaaatctcccgttactggaacgacatccctgctgaccagtacgagagcctcaagtcg
cagctcttcacccacatcacccgcttcgccagcggctccaagatcgtgctgacccggctg
tgtgtggcgctggcctcgctggcgctcagcatgatgccggacgcctggccctgcgccgtg
gcagacatggtgcgcatgttccaggcggaggactccaacgtggacgggcgagcgcggtgc
ctggcgctgctggagctgctgacggtgctgcccgaggagtttcagaccagccgcctcccg
cagtaccgcaaggggcaggtacggagtgtcctggcgcaggagtgcggctctgtcttccct
ttgctggagcagctgctgcagcagcaggactccccgggtttcatcaagcagaaggtgttg
aagtgcttctccagctgggttcagctggagatcccgctgatggactgcgagaacctcatc
caggcagctttcacctctctgcaggacccagagctcttcgacacggcagtggaggctgtg
gtcaatgccatttcccagcccgatgctcagaggtatgtgaacacactcctcaagctcatc
ccgcccgtgctggggctccaggagcagctgcgccaggcagtgcagagcggggacatggag
acgtcacatggcatctgccgtatcgctgtggccttgggggagaaccactcccgggccctc
ctggaccaggtggagcattggcagagcttcctggccctggtcaacatgatcatgttctgc
actggcatccccggacactaccccgtcaatgaaaccaccagctccttgacactcaccttc
tggtacacactgcaggatgatatcctctcctttgaaccagacaagcaagcggtgtaccag
caggtctacaggcctgtctacttccagctggtggatgtgttgctgcacaaagcccagttc
ccctccgatgaggagtacggcttctggtcttcagatgagaaggagcaatttcggatatac
agggtggacatctctgacacgctgatgtacgtgtatgagatgctgggtgctgagctcctg
agcagcctctacgacaaactgggacgtctcctgaccaacacggagcagccgtccacgtgg
cagcacacggaggccttgctctatggcttccagtccattgctgagaccattgacgtaaac
tactccgatgtggtgccagggctgatcggcctcatcccccggatcagcatcagcaacgtg
cagctcgccgacaccgtcatgttcaccatcgggtccctgtccgagtggctggccgatcac
cccgtcatgattaacaatgtgttgccgctggtgctccaagccttgggcaatcctgagctc
tccatctccagcgtctctaccctgaaaaagatctgccgggagtgcaagtacgacctgcca
ccttatgctgccaacattgtcgctgtgtcgcaggaggtgttgatgaagcagattcacaag
acaagccagtgcatgtggctgatgcaggcccttggtttcctgctttctgcactgcaagtg
gaggagatcctgaagaacctgcactccctgatcaccccttacatccagcagctggaaaag
ctggctgacgaaacgcccaatccctccaacaggctggccatcatccacatcctgggcctg
ctctccaacctcttcaccaccctagacatcagccaccacgatgatgaccacgaaagcaca
gaggtcaagaaactgccagtgcagcaaggacccaacccagtggtggtggttcttcagcaa
gtcttccagctcatacagaaggttctcagcaagtggctgaatgatgcccaggtggtggag
tctgtctgtgccatatttgagaagtctgtgaagaccctcctggacgattttgcccccatg
gtgcctcagctgtgtgagatgctggggcagatgtacagcaccataccccaggtctctgcc
attgaactcacccggcagctggttcacatctttgcccatgagcctgcccacttccctccc
atcaaggccctcttcttgctcgttacctcagtcacactgaccctgttccagcaagggccc
agggatcatcctgatattgttgattcatttatgcaactcctggcacaggctctgaaaagg
aagccagacctcttcctgtgtagcaacctggatgtcaaagcagtgtttcagtgtggtgtc
ctttcactcaagtttcctgaggccccaacagtcaaatcatcctgcggcttttttacggag
ctgctgccccgctgtggagagatcgccccggtgggacaggtcgtgcaggagaacggcaaa
gtgctgctgcaggcagtgctggagggcattggtggccaggcttcccgcagcctcatggat
cacttcgcagaaatcctctttgccttgaacaagcactgcttcagcctcctgagcgtctgg
atcaaggaggccatgcagcaggacggcttcccctcggcccgcgtcactccagagcagaag
gaaaacttcagccagcagatcctcagcagagagcgtgtgaacaagcggcgagtgaaggag
atggtgaaggagttcaccttgttgtgccgagggctgcacggtacggagtacacagcagac
tactga

DBGET integrated database retrieval system