KEGG   Empidonax traillii (willow flycatcher): 114062117
Entry
114062117         CDS       T05887                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114062117 (CDK6)
   04115 p53 signaling pathway
    114062117 (CDK6)
   04218 Cellular senescence
    114062117 (CDK6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114062117 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114062117 (CDK6)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     114062117 (CDK6)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   114062117 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 114062117
NCBI-ProteinID: XP_027748985
LinkDB
Position
Unknown
AA seq 326 aa
MDKDSTNLADQQYEYVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMLQLFRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATAVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEE
EDWPNDVALPRNAFTSRPAQPIEKFVPDIDELGKDLLLKCLAFNPAKRISACVALSHPYF
HDLEKFKENLDCHMSSSQNSSEVNAS
NT seq 981 nt   +upstreamnt  +downstreamnt
atggataaggacagcacaaacctggctgaccaacagtatgaatatgtggcagagattggg
gaaggagcttacggaaaggtgttcaaagcccgagacttgaagaacggaggtcgctttgtc
gcgctgaagcgggtacgggtgcagaccagtgaggagggaatgccactgtctaccatccga
gaggtggcagttttgaggcacctggagacgttcgaacaccccaacgtggtcagattgttt
gatgtgtgcaccgtgtcccgaacagacagagagaccaagttaacattagtgtttgaacat
gtggatcaagacttgactacttacttggataaagttccagagcccggagtgcctactgaa
actataaaggatatgatgcttcagctgtttcggggactggattttctgcattcgcatcgt
gtggtgcatcgggacctgaaacctcaaaatatccttgtaaccagtaacgggcagataaag
ttagctgactttggccttgcacgaatctacagttttcagatggctcttacctcagtggtt
gttactttgtggtatagagctcctgaagtcttgcttcagtccagttatgcaacggcagtt
gatctttggagtgttggctgcatatttgcagaaatgttccgtcgaaaaccactcttccgt
ggaaattcagatgttgatcagctaggaaaaatctttgatgtaattggactcccagaggaa
gaggactggcctaatgacgttgcccttccaagaaacgcttttacttccagacctgcacaa
cctattgaaaaattcgtaccagatattgatgaactaggcaaagacttgcttcttaaatgc
ttagcattcaatccagccaagagaatatctgcctgtgttgccctctctcacccatatttc
catgatctggagaaattcaaggagaatctggactgtcacatgtcatccagccaaaactcc
agtgaggtgaatgcatcttaa

DBGET integrated database retrieval system