KEGG   Empidonax traillii (willow flycatcher): 114062165
Entry
114062165         CDS       T05887                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04120  Ubiquitin mediated proteolysis
etl04144  Endocytosis
etl04218  Cellular senescence
etl04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114062165 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114062165 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114062165 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    114062165 (MDM2)
   04115 p53 signaling pathway
    114062165 (MDM2)
   04218 Cellular senescence
    114062165 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114062165 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114062165 (MDM2)
   04121 Ubiquitin system [BR:etl04121]
    114062165 (MDM2)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114062165 (MDM2)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114062165 (MDM2)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    114062165 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 114062165
NCBI-ProteinID: XP_027749099
LinkDB
Position
Unknown
AA seq 484 aa
MCNTKMSSLTDASAVTGSEQEALVKPKPLLLKLLKLAGAEKDTFTMKEVIFYLGQYIMSK
QLYDEKQQHIVHCANDLLGDLFGVTSFSVKEHRRLYSMISRNLMAVNQQDSTLGGTPEDD
ARSQLKEENVLKESMQELEEKQTSSNVTSRPTTSSRRRTHSESEENSLDDLHSDRRKRHK
SDSISLTFDESLSWCVVSGLCRERSNSSDSTDSLSIPDLDASSLSENSDWFDHSSVSDQF
SVEFEVESIYSEDYSHNEEGQELTDEDDEVYQLTIYQDEDSDGDSFDEDPEISLADYWKC
PECSEMNPPLPRHCHRCWALREDWLPDEKSEKLEKSKSEGPFPAESEEGFDVPDCKKTKM
TEDKEPALNENEEKAVQISESQESEDYSQPSTSSSMFCSSQEDYKEPEKREMQDKEESME
SCLPVTSIEPCVICQSRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVL
TYFS
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtgcaataccaagatgtcctcccttacggatgcctccgctgtcaccggctcggagcaa
gaggcgctggttaaaccaaagccactattgctgaagttgttaaagttagctggtgcagaa
aaggacacttttactatgaaggaggtaatattctatcttggacaatatattatgtctaaa
caattatatgatgaaaaacagcagcatattgtacactgtgcaaatgatctcctgggggat
ttatttggagtaacaagcttttcagtaaaagaacacaggagactatattcgatgatttcc
agaaatctgatggcagtcaatcaacaagactctacgcttggtggcacacctgaggatgat
gccagatctcagctcaaagaagaaaatgttcttaaggagtctatgcaagagttagaagag
aaacagacttcatcaaacgtgacttcccgaccaactacatcttctaggaggaggacacac
agtgaatctgaagaaaattctttggatgatctgcatagtgacagaagaaagcgacacaag
tcagacagcatttcgttgacgtttgatgaaagtctctcatggtgtgtagtcagtgggctg
tgccgtgaaagaagcaatagcagtgactcaacagattctctttccattcccgatcttgat
gctagttcattaagcgaaaactctgattggtttgaccacagttctgtttcagaccagttc
agtgtagagtttgaagttgagtctatttattcagaagattacagccataatgaagaagga
caggagctcacagatgaagatgatgaggtttatcagcttactatttaccaggatgaagat
agtgacggtgattcatttgatgaagatccagagatttccctagctgattactggaagtgt
cctgaatgtagcgaaatgaatcctccgcttccacgacattgccacagatgctgggcccta
cgtgaggattggcttccagatgaaaaaagtgagaaattggaaaagagcaaatcagaaggt
cccttccctgcagagtctgaagaaggttttgatgttcctgactgcaagaaaacaaaaatg
actgaagataaagaaccagctctgaatgagaatgaggagaaggcagtacaaatttccgag
tcccaggaaagtgaagattattcccagccgtcaacatcaagcagcatgttttgtagcagt
caggaggactataaggaacctgagaagagagaaatgcaagacaaagaggaaagcatggaa
tcctgtctgcctgttaccagcatagagccctgtgtcatatgtcagagcagacctaaaaat
ggctgcatagtacacggcaaaacgggacacctcatgtcatgttttacatgcgcgaaaaag
cttaagaagaggaacaaaccctgcccggtgtgcaggcagcccatacaaatgattgtacta
acttattttagttag

DBGET integrated database retrieval system