KEGG   Empidonax traillii (willow flycatcher): 114062209
Entry
114062209         CDS       T05887                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114062209 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 K_oxygenase NAD_binding_9 DAO GIDA Peptidase_S28 NAD_binding_8 FAD_binding_3 AlaDh_PNT_C DUF4147 YopD Thi4 Lycopene_cycl
Other DBs
NCBI-GeneID: 114062209
NCBI-ProteinID: XP_027749184
LinkDB
Position
Unknown
AA seq 373 aa
MGSRLSLDDSVRVVVVGGGFGGTAAASLLKSWAVPFVLVDARDAFHHNVAALRAAVESGF
AKKTFISYSITFGDSFRQGKVVGIDPGRQQVLLSDGEELHYSHLILATGSDGPFPGKFNK
VIDMESAIQTYEDMVKEVEKSERILVVGGGSAGAEMAAEIKTEYPAKEVILLHSKPALAD
VELLASVRQVVKEILLRKGVRLLLSERVRDVENLTVNQFQKDMVVRTEKGTEVVVDMVVL
CTGIKINSSAYAAAFGDKMASNGALKVNKHLQVEGYENIYAIGDCADLKEPKMAYHAGLH
ADIVVTNIINSLTQKPLKTYEPGSLTFLLSMGRNDGVGQVNGYYVGRLLVTIAKSRDLFV
SKSWKTMGQTMPS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggggtcccgcctgtccctggacgactccgtgcgggtggtggtggtcgggggcggcttc
gggggcacggcggccgccagcctgctcaagtcctgggccgtgcccttcgtgctggtggac
gcgagggatgctttccatcacaacgtggccgcgctccgggccgccgtggagagcggattt
gccaagaagactttcatctcctactccatcacctttggggacagcttccgacaaggcaag
gttgtgggcatagaccccgggaggcaacaagtcctgctcagtgatggtgaggagcttcac
tactcccatctcattcttgcaacaggcagtgatgggccattccccgggaagttcaacaaa
gtcattgacatggaaagcgccatccagacctacgaagacatggttaaagaggttgagaaa
tctgagcgcatcctggtagtgggaggtggttctgctggagctgagatggctgctgagata
aaaacggagtacccagccaaagaggtcatcctgttgcactccaaacccgccctggctgat
gtggagctgctcgccagtgtccgtcaagtggtcaaggagattctcctcaggaaaggagtg
cggctcctgctgagtgaaagggtcagggatgtggaaaacctcacggtaaaccagttccag
aaggacatggtggtgaggacagaaaagggcaccgaggtggttgttgacatggtggtgctg
tgcacggggataaagattaactcttcagcgtacgctgctgcatttggtgacaaaatggca
agtaatggtgctctgaaagttaacaagcacctccaggtggaaggctacgagaacatctac
gccattggggactgtgcagatcttaaagagcccaagatggcctaccatgctgggctccac
gccgacatcgtggtgacaaacatcatcaacagcctcacacagaagcctcttaaaacctac
gagccagggtcactgacattcctgctgtccatgggcaggaatgacggcgtgggccaggtg
aacgggtactacgtgggccgtctcttggtgaccattgccaagagccgggacctgttcgtc
tccaagagctggaagacgatgggacagacaatgccctcttag

DBGET integrated database retrieval system