KEGG   Empidonax traillii (willow flycatcher): 114062400
Entry
114062400         CDS       T05887                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114062400 (ZMAT3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz TUTase zf-C2H2_2 zf-U1
Other DBs
NCBI-GeneID: 114062400
NCBI-ProteinID: XP_027749551
LinkDB
Position
Unknown
AA seq 289 aa
MILLQQSALLSHPEKPSSLPMSVATRPRASSPLSPPKSLGLGPSFHHTQEEELAKVVEQD
PMLEELCKPLCCKLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAANSCPAPARMSNAVEPA
PPQVVSLPTQMGSSKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QNNSFSDASELGKRRARKEGNEYKMMQNRRNMYTVQNNTGPYFNPRSRQRIPRDLAMCVT
PSGQFYCSMCNAGASEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYVQ
NT seq 870 nt   +upstreamnt  +downstreamnt
atgattcttctacagcaatcagcacttctttctcatcctgagaagccttcatctcttcct
atgtcagtggctacaaggccaagagccagctcaccactgtccccaccaaagtctctcgga
ctggggccttccttccatcacacacaagaagaagaacttgcaaaggtggtggagcaggac
cctatgctggaggaactatgtaagcccctgtgctgtaagctgtgcaatgtcaccctgaat
tcggcccagcaagcccaggctcattaccagggtaaaaaccacagtaagaaactccgaaat
tactatgctgccaacagctgcccggcacctgccaggatgagtaatgcggttgagcctgcc
ccgcctcaggttgtctcccttcccacccagatgggatccagtaagccaggtggccgagtg
atcttggctacagagaatgattactgcaagctctgtgacgcctcgtttagctctccggcc
gtggcacaggctcactaccaggggaaaaatcacgccaaaaggctgcgccttgcagaagca
cagaataactcgttctcggatgcgtcagagctgggcaagcggagggcaaggaaagaaggg
aatgaatataagatgatgcagaacagaagaaacatgtacacagtgcagaacaacacaggt
ccctacttcaacccccgctcgcgccagaggatccctcgggacctggccatgtgcgtcacg
cccagcggccagttctactgctccatgtgcaacgccggcgccagcgaggagatggagttc
aggcagcacttggagagcaaacagcataagagcaaggtgtccgagcagcggtacaggaac
gagatggagaacctgggctatgtacaatga

DBGET integrated database retrieval system