KEGG   Empidonax traillii (willow flycatcher): 114062570
Entry
114062570         CDS       T05887                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114062570 (CACNA1E)
   04020 Calcium signaling pathway
    114062570 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:etl04040]
    114062570 (CACNA1E)
Ion channels [BR:etl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114062570 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 114062570
NCBI-ProteinID: XP_027749955
LinkDB
Position
Unknown
AA seq 2004 aa
MGVPGKGGELDGASPHYILALPEEETWRKHRLGLMQTTHSCNLLEPEGLAEALVSRAASF
DALYEPRSQDADADTGSAFDLGLGQDVPVSPDVIKRRRGGLIEQRDIIKAHEAHKMQSTP
QARRKEWEMARFGEAVAGRLGSGDGGSDQNRSRQGAPAPAGGSPGAFKQTKAQRARTMAL
YNPIPVRQNCFTINRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHL
PEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGI
LATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAI
LMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQF
DNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSG
EFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRR
ATIKRNRTDAMNRDSSDEHCVDISSVGERRLAQRRPLHPTLGNPLSHSGLKGARMDSASY
LRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLG
LFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLL
RIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPS
ANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNV
FLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMS
MWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKP
GDGVTLEKCTEEQGKGERPLAEGPEQPVLGANPSGGEERRSPSPRAKRDKEMWQQKSCHG
NCEPGEQDGAGGSVEDRARMRQSQRRSRHRRARMEGKEQAGILGSRSASQEMGLEEASAM
EGAQDGDRRGDVAAAEVLIQGEPEASGESVRTNGVPAGDADLIGTAKKGSPPHAVPEPHQ
GKTGNLTEQDCSSPDTSEQALLQGSRTVSRSEPDLSSITPNTEKATESTTIMIDVHDSAV
VHISNKTDGEASPLKEAETKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRA
CHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKM
IDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRP
LKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDT
QKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVT
EEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERA
CIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYT
YELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLV
NTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIG
MQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTAT
SGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFV
RIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKVDQPFLLWGSELSRTWG
SRDVREVGLGEPGRCWGVQHVFSLPLGSLLGSEEPWPRWLVSTAHACDTAMVTQSPGMED
PSGRGSAIVWKWEGCRRGGEEQHW
NT seq 6015 nt   +upstreamnt  +downstreamnt
atgggcgtgccaggcaaggggggtgagctggatggcgcctccccccactacatcctggcc
ctgcccgaggaggagacgtggcgcaagcaccggctcggcttgatgcaaaccacccactcc
tgcaacctgctggagcccgagggcctggccgaggccctggtctcgagggctgccagcttt
gatgccctctacgagccccgctcccaggatgctgacgcggacaccggcagcgccttcgac
ctggggctgggccaggacgtgcccgtgagcccggacgtcatcaagcgccggcggggcggg
ctgatcgagcagagggacattatcaaggcacacgaggcacacaagatgcagagcacgcca
caggcacggaggaaggagtgggagatggctcgctttggggaggcagtggctggcaggcta
ggctctggagatgggggctccgaccagaaccggagccggcaaggagctcctgcccctgca
ggagggagcccgggagccttcaagcaaaccaaagcgcagagagcccggactatggctctg
tacaaccctatccctgtccggcagaactgcttcaccatcaacagatcgctcttcctcttt
ggggaagagaacatagtcaggaaatatgccaagaagctcattgactggcctccctttgag
tacatgatcctggcgaccatcattgccaactgcatcgtgctggcccttgagcagcacctc
cccgaggacgacaagacacccatgtcacggagattagagaagacggagccgtacttcatt
gggattttctgctttgaggctgggattaagatcgtggccctggggttcgttttccacaag
ggctcgtacctgcgcaacggctggaacgtcatggacttcatcgtggtcctcagcggcatc
ctcgccaccgctgggacacacttcaacacccacgtggacctgcggacgctgcgggccgtg
cgcgtgctcaggcctctgaagcttgtctcgggcattcccagcttgcagattgtcttgaaa
tccatcatgaaggccatggtgccccttctgcagattggcttgctgctcttttttgctatc
ctcatgtttgccatcattggcctggagttctacagcgggaagctgcaccgagcctgctac
acaaacaattcaggtgaactagaggagctggaccctccccatccatgcggggtgcagggt
tgccccccaggctacgaatgccgggagtggatcggtcccaacgatgggatcacgcaattc
gacaacatcctttttgctgtgttgaccgtcttccagtgcatcaccatggaagggtggacc
acagttctgtacaataccaatgatgccttaggagccacctggaactggctgtacttcatc
cccctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtgctgtcaggg
gagtttgccaaagagcgtgagcgagtggagaaccgccgagccttcatgaagctgcggcgc
cagcagcagattgagcgggagctcaacggataccgggcatggatagacaaagcggaggaa
gtcatgctggctgaagagaacaaaaattctgggacctcagccttagaagtgctcaggcga
gccaccatcaaaaggaaccgtacagatgccatgaaccgtgactcgagcgatgagcactgt
gtcgatatctcctctgtgggcgagcggaggctggcacagagaagacctctccatccaacc
ttgggtaaccccttgagtcactctggcctcaaaggtgccagaatggacagtgcctcctac
ttacgacacaaggagcgactcctgcgcatctccgttcgccacatggtgaaatcccaggtc
ttctactggatcgtcctgagcctggtggctctcaacaccgcctgtgtggccatcgtccat
cacaaccagccagcctggctcacccacttcctctactatgcagagttcctgtttcttggg
ctcttcctgctggagatgtccttaaagatgtatgggatggggccacgcctttatttccat
tcttccttcaactgctttgactgtggggtcacagtgggaagcatctttgaagtggtttgg
gctatattcagaccaggaacctcttttgggatcagtgtcctacgagcccttcgtctcctg
cggatatttaaaataaccaagtactgggcatccctgagaaatttggtggtctccctgatg
agctccatgaagtctattatcagccttctcttcctcctcttcctcttcattgtagtcttt
gccctgctgggaatgcagctgtttggaggcaggtttaacttcatggatgggactccatca
gccaacttcgacactttccctgcggccatcatgacagtgtttcagatcctgactggtgag
gactggaacgaggtgatgtacaatggcatccgctcccagggaggtgttcgctcagggatg
tggtcctccatctatttcatcgtcctcaccttgtttggaaactatactctgctgaacgtc
ttcttggccattgccgtggacaacctggccaatgcccaggagctcaccaaggatgagcag
gaggaagaggaggcctttaaccagaagcacgcccttcagaaagccaaggaagtcagcccc
atgtctgccccaaatatgcctgctatcgaaagagacaggcggaggagacaccacatgtcg
atgtgggagccacgcagcagccacctgcgggagcgtcgccggcggcaccacatgtcggtg
tgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggagggcatc
aacaaggacgagccacccctcatcaacccccacgccagcatcttccgcaggaagaaacca
ggggatggcgtcaccctggagaaatgcaccgaggagcagggcaagggcgagcggccgctg
gcggagggaccagagcagcctgtcctgggagccaatcccagcggtggtgaggagaggagg
agcccatcgccccgggccaagcgggacaaggaaatgtggcagcagaaatcatgccatggg
aactgtgagccgggcgagcaggacggggcaggtggcagcgtcgaggatagagccaggatg
aggcagagccagcggcgcagccggcaccgcagagcccggatggaggggaaggagcaagct
ggcatcttggggagccgctcggccagccaggaaatgggtctggaggaggccagcgccatg
gagggggcacaggatggggaccggcgtggggacgtggccgcagccgaggtgctgattcag
ggggagccggaggcaagcggagagtctgtcaggacaaatggggtccctgccggcgatgct
gatctgattgggactgccaagaaggggagccccccacatgcagtccccgagccccaccag
gggaagacaggcaacctgacagaacaggactgcagcagcccagacaccagcgagcaggcg
ctgctgcagggcagtcgcaccgtcagccggagcgagcctgacctctcctccatcaccccc
aacactgagaaggccacggagagcaccaccatcatgatcgatgtccacgactctgctgtg
gtacacattagcaacaagacagatggtgaagccagccccttaaaggaggccgagaccaaa
gaagatgaggaggaaatggagaagaagaagcggaagaaggaaaaaagcgagacaggcaaa
gcaatggtgccgcacagctccatgttcatcttcagcaccaccaacccggtgcggagggcc
tgccactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtgattgccgcc
agcagcatcgccctggcggccgaggatcccgtcctcaccaactccgaccgcaacaaagtc
ctgaggtattttgactatgtcttcactggcgtcttcaccttcgagatggttatcaagatg
attgatcaaggcttgatcctgcaggatgggtcctacttccgagacctctggaacatcctg
gatttcatcgtggtggtgggagcactggtggcttttgccttggcgaatgctttggggacc
aacaagggacgggatatcaagaccatcaagtctctccgtgtgctgcgggtcttgaggcct
ctgaaaaccatcaagcgactgcccaagctgaaggccgtctttgactgtgtcgtgacatcc
ctcaagaatgtcttcaacatcctcattgtctacaagctcttcatgttcatctttgctgtt
attgccgtccagctcttcaaggggaagtttttctactgtactgacagctctaaggacaca
cagaaggactgcatagggaactacgtggaccacgagaagaacaagatggaggtgaaatgt
cgagagtggaaacgtcatgagtttcactacgacaatatcatctgggctttgctcaccctg
ttcacagtctccaccggcgagggttggccccaggtgctgcagcattcggtggacgtgaca
gaggaggaccgcgggcccagccgcagcaaccgcatggagatgtccattttttatgtcgtc
tattttgtggtcttccctttcttcttcgtcaacattttcgtggctctcatcatcatcacg
ttccaagagcaaggagacaaaatgatggaggagtgcagtctggagaagaacgagagggcc
tgcattgactttgccatcagtgccaagcccctcacacggtacatgccccagaaccgacac
accttccagtaccgcgtctggcacttcgtggtgtccccatccttcgagtacaccatcatg
gccatgatagcgctgaacaccgtggtgctgatgatgaagtactactctgctccatacacc
tatgagctggccctgaagtacctgaacatcgccttcaccatggtgttctccttggagtgc
gtcctcaagatcatcgctttcggcttcctgaattatttccgggacacctggaacatcttt
gacttcatcactgtcattgggagcattacagagatcatcctgacagacaccaagctggtg
aacaccagtagtttcaacatgagcttcctgaagcttttccgggctgctcggctcatcaag
ctgctccgccagggttacaccatccgcatcctcctctggacatttgtgcagtccttcaag
gcactcccctatgtctgcctcctgatcgccatgcttttcttcatctacgccatcattggg
atgcaggtttttggcaatatcaaactggatgaggaaagccacatcaaccgacacaacaac
ttccgcagcttcctgggctcccttatgctcctcttcaggagtgccacaggagaggcctgg
caggagatcatgctgtcctgcctggagggcaaaggctgcgagccggacacgacggcaaca
tctgggcagaacgagaacgagcgctgtggaaccgacctggcctacgtttactttgtctcc
ttcatcttcttctgctccttcctgatgctcaacctgtttgtggcagtcatcatggacaat
tttgagtacctgacaagggattcctccatcctgggacctcaccatctagatgagtttgtc
cggatctgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtat
gaaatgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtg
gcctataaggtagatcaacccttccttctatgggggtcagagctgagtaggacctggggc
tcaagggacgtgcgggaggtgggactgggggagccggggaggtgctggggtgtccaacat
gtgtttagcttgcccctggggagcctgctgggctcagaagagccctggccacgttggctg
gtctccactgcccacgcatgtgacactgccatggtcactcagagccccgggatggaagac
cccagtggaagaggatcagcaatagtgtggaagtgggagggttgcaggagaggaggtgag
gagcagcactggtag

DBGET integrated database retrieval system