KEGG   Empidonax traillii (willow flycatcher): 114062647Help
Entry
114062647         CDS       T05887                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00010  Glycolysis / Gluconeogenesis
etl00053  Ascorbate and aldarate metabolism
etl00071  Fatty acid degradation
etl00280  Valine, leucine and isoleucine degradation
etl00310  Lysine degradation
etl00330  Arginine and proline metabolism
etl00340  Histidine metabolism
etl00380  Tryptophan metabolism
etl00410  beta-Alanine metabolism
etl00561  Glycerolipid metabolism
etl00620  Pyruvate metabolism
etl01100  Metabolic pathways
Module
etl_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114062647 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    114062647 (ALDH2)
   00620 Pyruvate metabolism
    114062647 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114062647 (ALDH2)
   00561 Glycerolipid metabolism
    114062647 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114062647 (ALDH2)
   00310 Lysine degradation
    114062647 (ALDH2)
   00330 Arginine and proline metabolism
    114062647 (ALDH2)
   00340 Histidine metabolism
    114062647 (ALDH2)
   00380 Tryptophan metabolism
    114062647 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114062647 (ALDH2)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     114062647 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 114062647
NCBI-ProteinID: XP_027750143
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MLQALVRSSRLCPAQLRASFSAASASPIPAPNPRPDIACNKIFINNEWHDAVSKKTFPTI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASQRGKLLHRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYCAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSGLYVASLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIVMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGKREGAKLLCGGNPAADRGYFIQPTVFGNVQDNMTIAREEI
FGPVMQILKFRTMEEVIERANDSKYGLAAAVFTKDLDKANYVSQSLRAGTVWINCYNVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggcgctggtgcgcagctcccggctctgcccggcccagctccgggcgtccttc
tcggccgcctccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctgcaac
aagattttcataaataacgaatggcacgatgctgtcagcaagaaaaccttccccaccatc
aacccagccacgggggaagtcatctgccaggtggctgagggcgataaggcagatgtggac
aaggcggtgaaggcagccaaggcagcgttccagctgggctctccctggaggaggatggat
gcttcccagcgggggaagctgctgcaccgcctcgccgacctgatcgagcgggaccgggcc
tacctggcggctctggagactctggacaatggcaaaccctatgccatctcctacctggtg
gatctggacatggtggtcaagtgtctcagatactgtgcaggctggtcggataaattccat
gggaaaaccatcccgttagacggagacttcttctgctacacgagacatgagcccgtggga
gtttgtggccagataatcccatggaacttcccactgttgatgcaagcctggaaactgggg
cctgccctggccactggcaacgtggtggtgatgaaggtggcagagcaaacccccctgagc
ggcctttacgtggccagcctgattaaagaggctggattcccaccaggagtggtgaacatc
atccctggctatgggcccacggcaggggctgccatctcctcccacatggacattgataaa
gtggctttcactggctccacagaggttgggcacctgatccagaaagctgcagcagagagt
aacctgaagagggtgaccctggagcttggagggaagagccccaacatcgtcatgtctgat
gcagacatggactgggcggtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgccggctcccgcacgtacgtgcaggaggacatttacaacgagttcgtggag
aggagtgttgagaaggccaaggctagggtggttggaaaccccttcgactttaaaaccgag
caggggcctcaggtggatgaggagcagttcaagaagatcctgggttacatcagcactggg
aagcgtgaaggagccaaactgctgtgtggtggcaaccccgctgctgacaggggctacttc
atccagcccacggtcttcgggaacgtgcaggacaacatgaccattgccagggaggagatc
ttcgggccggtcatgcagatcctgaagttcaggacgatggaggaggtcatcgagagggcc
aacgattccaagtacgggttggcggccgccgtgttcaccaaggacctggacaaggccaac
tatgtgtcccagagcctgcgggctggcacggtctggatcaactgctacaacgtgtttggt
gcccaggccccctttgggggctacaaggcctctgggaacgggcgagagctgggggaatac
gggctggaggcctatgtggaggtgaaaaatgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system