KEGG   Empidonax traillii (willow flycatcher): 114062798Help
Entry
114062798         CDS       T05887                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114062798 (RET)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114062798 (RET)
Protein kinases [BR:etl01001]
 Receptor tyrosine kinases (RTK)
  RET family
   114062798 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD3 RET_CLD1 Pkinase RET_CLD4 Cadherin RIO1 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 114062798
NCBI-ProteinID: XP_027750450
LinkDB All DBs
Position
Unknown
AA seq 1111 aa AA seqDB search
MSPVPGLGDDQVSHNHCTKKKFAFGLYFPRKEYFENVYIDEPAGMPLLRIHALKDSYEEV
AHFHLCQNLIVSRARSQENNWFQIREKTGLLYLSKSLDRDDFNMLSVGNWMPLSKVMLYV
FLSSHPFQEKECDSATRATVFLSLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTF
HQLRLPSVHHLCQNLSISYKLLAAEGLPFRYNENTTSVRVTQRLDREERERYELIAKCTV
REGFREMEVEVPFLVNVLDEDDSPPFLPNGTDTADAVVEFNRKEGTVLATLTVYDADTTP
IYPLESSRKKYTGTIVTDDPWISETFRVEHIFDEIHFSPNGSQVRGTRHEYKLVLNKSIS
VTEHRYFQLDVLVNDTEFHGPERSVMLHFNVSILPVSIQFSNITYQFTVNRNAERFAQIG
KICIENCMKFRGVNITYKLLSPNASCSPVGILQGREDKYGSLYVNDSSVLRRAECKEIQY
TVQATDKQSRKHTKTLLTVVLEGTLLKKEEDCPDSCAISKHRAECEECGGLGVLTGRCQW
RQGSGKGITTNYSTCTPSIKTCPDGICDVVESRDPAVCPQDCTSGNIIGGHGKGTGNLGI
KSGHGICYCFPRQNCYCEKDDIKEQLCDEVCKTVIAGAVLLSFIISVLLSSYFIHRYHKN
SPKPPIASAEMTFRRPAQSYPISYSSSNVRRPSLDSMENQVSVDTFKIPEDPKWEVPRKN
LVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVN
HPHVIKLYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNPDE
RALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEED
SYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNL
LKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPTFTEISKELEKMMVKSRDYLDLAASTP
SDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFDGT
NSVFSRYANDSVYANWMVSHSAAKFMDKFDS
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgtgccagggttgggagatgatcaggtcagtcacaaccattgtactaaaaag
aaatttgcctttggtctctacttccccaggaaagagtactttgagaatgtgtacattgat
gagccagcaggtatgcctctcctgcgcatccatgccttgaaggattcatatgaggaggtg
gcccactttcatctgtgccagaatctcatagtttctcgagcaagatcccaggaaaataac
tggtttcaaatcagagaaaaaacaggacttctctacctcagcaaaagcctggatagagac
gactttaacatgttgtctgtaggaaactggatgccattatcaaaggtgatgctgtatgtc
ttcctttcatcccaccctttccaagagaaggaatgtgactctgctacacgcgctacggtt
ttcctctctttgatcaatgctacagcaccagcttgcagttccttgacagcaaggcaactt
tgcttcacagaaatggatctctcctttcacatcaaggagaataaaccacctggcacattt
catcagcttcggttaccctcagttcatcatctgtgtcagaatctcagcatttcctacaaa
ctgttagcagctgagggtctgccctttcgatacaatgagaacaccaccagtgtgcgtgtg
acacagcgcctggaccgagaggagagagagagatacgagctgattgccaagtgcaccgtg
agagagggattcagggaaatggaggttgaggtgcccttcctggtgaatgtgttggatgaa
gatgactctcctcccttccttcccaatggcactgatactgcggatgctgttgtggagttc
aacaggaaagagggaactgttcttgcaacgctgactgtgtacgatgcagacaccacaccc
atttatccccttgaaagcagcaggaagaaatacacaggaaccattgtcactgatgatccc
tggataagtgaaacatttcgtgtggagcacatttttgatgaaatccacttcagtccgaat
ggcagccaagtgaggggaactcgacatgagtacaaactggtactgaataaaagcatttca
gtcacagagcatcgttacttccagttggatgttttggtgaatgacacagaatttcatggc
ccagaaagatcagtgatgcttcatttcaatgtctccatcctccctgtcagcattcagttt
tcaaacataacttaccagttcacagtgaacagaaacgccgaacgctttgcacaaatagga
aaaatctgcattgaaaactgtatgaaattccgtggtgtaaacatcacctacaagttgctg
tcccccaatgcaagctgctctcctgttggcatccttcaaggccgagaagacaaatatgga
agcctttatgtgaacgattcctctgtgctgcgcagagcggaatgcaaggaaatacaatac
actgttcaagctacagacaagcagagcaggaaacacaccaagaccctcctcactgttgta
ttggaaggaactcttttaaaaaaagaagaggactgccctgactcttgtgctatcagtaag
caccgtgctgaatgtgaagagtgtggtggcctgggagtactaacaggaagatgccagtgg
agacaaggcagtggaaaagggatcaccacaaactattccacgtgcaccccgagcatcaag
acttgtccagatggcatctgtgatgtggtggagagcagagatccggctgtgtgcccccag
gactgcacaagtggaaacattattggtggccatgggaagggcactggaaatcttggaatt
aagtcaggacatggaatttgttactgcttcccaagacagaactgttattgtgagaaagat
gatatcaaagagcaactgtgtgatgaagtgtgcaagactgtgatagcaggggcggtgctg
ctgtcgttcatcatctccgtgctgctttcttcctatttcatccatcgttaccacaagaat
tctccgaaaccccctattgcctctgcagaaatgacgttccggcgcccagcccaatcctac
cccatcagttactcttccagtaatgtccgccggccttctctagattccatggagaaccag
gtgtccgtagacacctttaaaataccagaagatccaaagtgggaagttcctcggaagaac
ctagttctgggcaagactctcggagaaggagaatttggaaaggtcgtcaaggcaacagca
ttccgactcaagggaagggctggctataccactgtagcagtgaaaatgttaaaagaaaat
gcttcccagagtgagctgcgagatctactttcagagttcaacctcttgaaacaggtgaac
catccccatgtcatcaaactttatggggcctgcagtcaagatggcccactgtatttaatt
gtggaatatgcaaaatacggctctttgcgtagttttctcagggaaagtcgaaaagtaggc
ccaagctacgtgggtagtgatggtaacagaaactcaagttatttggacaaccctgatgag
agagccttgacaatgggagatctgatctcgtttgcgtggcagatatcccgaggaatgcag
taccttgcggaaatgaagcttgtgcatcgcgatttagcagccagaaatgtgttggtggca
gaagggcgcaaaatgaagatttctgattttggcctctcacgtgatgtatatgaagaagat
tcgtatgtaaagaggagcaagggtcgaatacctgtgaaatggatggcgatagagtcccta
tttgaccatatctatacaacacaaagtgatgtgtggtcatttggggttctgctatgggag
attgttactttgggaggcaatccctatccaggtattgctcctgaaagactctttaacctc
ctaaaaacaggctatagaatggagagaccagaaaactgcagtgaagaaatgtacaacctc
atgttgcgttgttggaagcaagaacctgataaaagaccaacatttactgagatcagcaag
gaactagagaaaatgatggtgaagagtagggactacttagatcttgcggcttccacgcct
tctgattccttactttatgatgatgggctctcagaagaggagacacctctcgtggactgt
aataatgctcccctccctcgaaccctcccttccacatggattgaaaacaaactctatggc
atgtcatacccgaactggcctgaggagagccccgttccactcacaagattcgatggcact
aactctgtgttttcaagatatgcaaatgatagtgtatatgctaactggatggtttcacac
tcagcggcaaaatttatggacaagtttgatagctaa

DBGET integrated database retrieval system