KEGG   Empidonax traillii (willow flycatcher): 114063086
Entry
114063086         CDS       T05887                                 

Gene name
STEAP3
Definition
(RefSeq) metalloreductase STEAP3 isoform X1
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    114063086 (STEAP3)
   04115 p53 signaling pathway
    114063086 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114063086 (STEAP3)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     114063086 (STEAP3)
Membrane trafficking [BR:etl04131]
 Exocytosis
  Others
   Others
    114063086 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C NAD_binding_2 IlvN Shikimate_DH NAD_binding_7
Other DBs
NCBI-GeneID: 114063086
NCBI-ProteinID: XP_027750914
LinkDB
Position
Unknown
AA seq 488 aa
MSRGDMAKPLLGHGSTEGDPSVTPASGRTIGVLGSGDFARSLAIRLVCSGFKVVVGSRNP
KRKASLFPSAAEVTFQAEAVKKTDIIFVAVFREHYSTLCDLADVLAGKILVDVSNNTEIN
HHKESNAEYLASLFPACTVVKGFNVVSAWTLQSGARDGNKQVLICSNNQEAKRTVAEIAQ
VMGFTPVDMGCMSSACEIENIPLRLLPAWKIPIFLALGLFLCFFTYNLIRQVIHPFIREQ
KNKLYKIPIEVVNTTLPCVSYVMLSLVYLPGVLAACSQLYYGTKYRRFPDWLDQWLQHRK
QIGLLSFFCAALHAVYSLCLPMRRSHRYLLIETAVKQAMEKKMNIWVEEEVWRMEIYISV
GIIALGLLSLLAITSLPSIANSLNWREFSFIQSSLGFIALVVSTLHTLTYGWSRAFDENQ
YKFYLPPTYTLTLLVPCTVIIAKVIFSLPCIRHRLLRIRRGWEKGRYVKFVLPSATGEYS
SGETSSNV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtccagaggagacatggccaagcccctcctgggccatgggagcacggagggtgacccc
agtgtgacgcccgcgtccggccgcaccatcggggtgctgggcagcggggacttcgcgcgc
tccttggccatccgcctggtgtgctccggattcaaggtggtggttggcagccgcaacccg
aagcggaaggccagcctcttcccttctgcagcagaggtcaccttccaggcagaggcggtg
aagaagacggacatcatttttgtggcggttttcagggaacattactccaccctctgtgac
ctggctgatgtgctggcgggcaagatcctggtggatgtcagcaacaacacagagatcaac
catcacaaggagtccaacgcagaatacttggcttccctgttcccagcctgcaccgtggtc
aaggggtttaacgtggtttctgcgtggacgctgcagtcaggtgccagagatgggaacaag
caggttctgatttgctcaaataaccaagaagccaagcgcactgtagcagaaattgctcaa
gtcatgggattcacccccgtggacatgggctgcatgtcatcagcctgtgagatcgagaac
attcccctgcgcctcttgccagcctggaaaatccccatctttctggctctggggcttttt
ctttgcttcttcacttacaacctgatccggcaggtcatccacccttttatcagggagcag
aagaacaagctgtacaagatccccatcgaggtggtcaacacgacgctgccttgcgtgtcc
tatgtcatgctgtccctcgtctacctgcccggggtgctggcagcctgctcgcagctctac
tatggcaccaaataccgacgctttccggactggctcgaccagtggctccagcatcgaaag
cagatcggtctcctcagcttcttctgcgcagccctgcacgccgtgtacagcctctgcctg
cccatgcgccgctcccaccggtacctgttaatcgagacggccgtcaagcaggctatggag
aagaagatgaatatctgggtagaggaggaagtctggagaatggagatttatatctctgtt
ggaattattgccctgggcttgctgtcgttacttgccatcacttcacttccatccatcgca
aactctctcaactggagggaattcagtttcattcagtccagccttggatttattgccttg
gtagtcagcaccctgcacacgctcacctacggatggtcgagggccttcgatgagaaccag
tacaaattctacctgcctcccacctacaccctcacgctgcttgtcccatgtactgtgatc
atagcaaaggtcatcttcagcctgccctgcatccggcacagactcctgcggatcaggagg
ggctgggagaaagggagatacgtcaaatttgttctgcccagcgcaacgggggaatattca
agtggggagacctccagcaacgtctga

DBGET integrated database retrieval system