KEGG   Empidonax traillii (willow flycatcher): 114063538
Entry
114063538         CDS       T05887                                 

Gene name
GORAB
Definition
(RefSeq) RAB6-interacting golgin isoform X1
  KO
K19748  RAB6-interacting golgin
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114063538 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114063538 (GORAB)
Membrane trafficking [BR:etl04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    114063538 (GORAB)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 114063538
NCBI-ProteinID: XP_027751660
LinkDB
Position
Unknown
AA seq 424 aa
MGGWKPLKNNFYTNTVKGSNWLMGRTLQSHRRKLPTKASTPPGTLNEEEVAVLWTRLHGE
ISGIVLQGYGKELYEPSEPQQQQQQPRPHPGNKPRKQLQREKALQQQCQRLGLQGGAAPV
TPEQLLSAPKHKPCHPQQPVPAPRPPPAGDQRQSDSRDQQEEVTPCNGRESAQPRPAQPS
AQVERKKVELQEKSRWEILQQEQRLIEEKNKRKKALLARAIAERSKRTQAETVKLKRIQK
ELQALDDMVSADIGILRNRIDQASLEYSHARKRYEKAESEYVAAKLDLQHKTELKEQLTE
HLCTIIQQNELRKARKLEELMQQLDVEADEENLELEIEVERMLQQQEAEAAGRGSQSHSH
AGTAKESPTASGAGREGERANHAAASPAVSEQSQNSGTKSLSSMDRQTQAVDVTSESSPA
CSAT
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggtggatggaaaccgctgaaaaacaacttctacacaaacactgtgaaaggcagcaac
tggctgatggggaggactctccaaagccacagaaggaagttacctactaaagcctcgaca
ccgccagggacgctgaatgaggaggaggtggctgtgctgtggacaagactccatggagaa
atatctggtatcgtactgcaaggatacgggaaagagctgtacgagccctcggagccacag
cagcagcagcagcagcctcgcccccaccctgggaacaagcctcggaagcagttgcagcgg
gaaaaagccctccagcagcaatgccagaggctgggactgcagggtggggcagcccctgtc
actccagagcagttgctctctgcaccaaagcacaagccctgtcaccctcagcagccagtg
ccagctcctcgtcctcctcctgctggagatcaaaggcaaagtgacagccgggatcagcag
gaggaggtgacaccttgcaatggcagggagagtgcccagccccgccctgcacagcccagc
gcccaagtggagagaaagaaagtggaattgcaggagaaatcccgatgggaaatcctgcag
caggagcagcggctgatagaggagaagaacaagcgcaagaaggctctgctggccagagct
attgctgagagatccaaaagaactcaagctgaaacagtgaaactgaagaggattcagaag
gagctgcaggctctggatgacatggtgtctgctgacattggcatcctgaggaaccgcatc
gaccaggccagcctggaatactcccatgcccggaagcggtacgagaaggcggagtcggag
tacgtggcggccaagctggacctgcagcacaagacggagctgaaggagcagctcacggag
cacctgtgcaccatcatccagcagaacgagctccgcaaggccaggaagctggaggagtta
atgcagcagctggatgtggaggcagatgaggaaaatctggaactcgagatcgaggtggag
cggatgctgcagcagcaggaggcagaagcagcaggacgaggcagccagtcacacagtcac
gctgggacagcgaaggagagccccactgccagtggtgcagggcgggagggcgagcgtgcc
aaccatgctgctgcttctcctgctgtttctgaacagtctcaaaactctggcaccaaatcc
ctctccagtatggacagacaaactcaagcagtagatgtgacttcggaaagctccccagct
tgttctgctacatga

DBGET integrated database retrieval system