KEGG   Empidonax traillii (willow flycatcher): 114063690
Entry
114063690         CDS       T05887                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl05132  Salmonella infection
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114063690
   04115 p53 signaling pathway
    114063690
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114063690
  09172 Infectious disease: viral
   05164 Influenza A
    114063690
   05168 Herpes simplex virus 1 infection
    114063690
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 114063690
NCBI-ProteinID: XP_027751945
LinkDB
Position
Unknown
AA seq 105 aa
MGDIEKGKKIFIQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKDATAK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatatcgagaaaggcaagaagatctttatccagaaatgttcccagtgccacaca
gtcgagaagggagggaagcataagactggacccaacctgcatggcctgttcggacgcaag
actggacaagctgcaggtttctcgtacacggatgctaataagaacaaaggtatcacctgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtatatcccaggaacaaag
atgatttttgcgggtattaagaagaaggctgagagagcagacttgatagcatacctcaaa
gatgccactgcaaagtaa

KEGG   Empidonax traillii (willow flycatcher): 114064043
Entry
114064043         CDS       T05887                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome c, somatic A-like
  KO
K08738  cytochrome c
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl05132  Salmonella infection
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114064043
   04115 p53 signaling pathway
    114064043
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114064043
  09172 Infectious disease: viral
   05164 Influenza A
    114064043
   05168 Herpes simplex virus 1 infection
    114064043
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 114064043
NCBI-ProteinID: XP_027752519
LinkDB
Position
Unknown
AA seq 127 aa
MGDVEKHENMFIQKCSQCHTVEKDGKHKTGPNLWGLFGCRTGQAAVFSYLDANKNKGKTN
TIHXQEHLENPEKYPPGLKIILAAIKKRNEXLMLFAYLKKATSLNIVSATAMLVKDVFIL
TSSFIKF
NT seq 384 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaacatgagaatatgtttatccagaaatgttctcagtgccatact
gttgaaaaagatggaaagcacaagacaggaccaaatctttggggtttatttggctgtaga
acaggacaagctgcagtattttcttacttagatgcaaacaaaaacaaaggcaaaactaac
acaatacactgacaagagcatttagaaaaccctgagaaataccctcctggtttaaaaatt
attcttgctgcaattaaaaagcggaatgaanagctgatgttatttgcatacctgaaaaaa
gcaacttcattgaacattgtttcagcaactgcaatgttagtgaaagatgtttttattttg
actagctcctttatcaagttttag

DBGET integrated database retrieval system