KEGG   Empidonax traillii (willow flycatcher): 114063866
Entry
114063866         CDS       T05887                                 

Gene name
CUL1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04120  Ubiquitin mediated proteolysis
etl04141  Protein processing in endoplasmic reticulum
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114063866 (CUL1)
   04120 Ubiquitin mediated proteolysis
    114063866 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114063866 (CUL1)
   04340 Hedgehog signaling pathway
    114063866 (CUL1)
   04350 TGF-beta signaling pathway
    114063866 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114063866 (CUL1)
   04114 Oocyte meiosis
    114063866 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114063866 (CUL1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     114063866 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 114063866
NCBI-ProteinID: XP_027752236
LinkDB
Position
Unknown
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcgaataggagtcagaacccgcatggacttaaacagattggtcttgaccagata
tgggatgaccttagagctggaattcaacaggtttacaccagacaaagtatggcgaaatcc
agatacatggaactctacactcatgtttataactactgtaccagtgtacaccagtctaat
caagcacggggagctggagtacctccttctaaatcgaaaaagggccagacacctggaggt
gctcagtttgttggcttggagttgtacaaacggctaaaagaatttctgaagaactacttg
acaaatctccttaaggatggtgaagatttgatggatgagagtgtgctgaaattctacact
caacagtgggaagattataggttttcaagcaaagtattgaatgggatatgtgcctacctc
aatcgacattgggttcgtcgtgagtgcgatgagggtcgtaaaggaatatatgaaatttat
tcacttgccttggtgacctggagagactgcttattcagaccattaaataagcaggtaaca
aatgcggtgttgaaactgattgaaaaggaaagaaatggtgaaactatcaatacaagactg
atcagtggagttgtacaatcctatgtggagctggggctgaatgaagatgatgcatttgca
aaaggacctacactaactgtctataaagaatcctttgaatctcagtttcttgctgacaca
gagagattttatacacgagaaagtactgaattcttgcaacagaacccagtcacagagtac
atgaagaaggctgaagctcgccttcttgaggagcagcgtagagttcaggtatatctccat
gagagcacacaagatgagttagcacgaaaatgtgagcaagtactcattgaaaaacacctg
gagatatttcatacagagtttcagaatttgttggatgctgacaaaaatgaagacttgggt
cgcatgtataaccttgtgtctcgaatccaggatggccttggagagctgaaaaaacttttg
gaaacccacattcataatcagggtctagctgcaattgagaaatgtggagaagctgctcta
aatgatccaaaaatgtacgtacagacagtgctggatgtccataagaaatacaatgcttta
gtcatgtctgcattcaacaatgatgctggctttgtggctgcactagacaaagcttgtggt
cgatttataaataataatgcagtgacaaaaatggctcaatcatccagtaaatccccagag
ctactggcacgatactgtgactctttactaaagaaaagctcaaagaatccagaagaagca
gaattggaagatacactcaatcaagtgatggttgtcttcaagtacattgaggataaagat
gtgtttcaaaaattctatgctaaaatgctggcaaagagacttgtacatcagaacagtgct
agtgatgatgctgaggcaagcatgatctctaaattaaaacaagcttgtggttttgagtat
acctccaagctgcagcggatgttccaagatattggtgtaagcaaggatttgaatgaacag
tttaaaaagcacctgaccaactcagaaccattagatttggatttcagcatccaggtgctg
agttctggatcgtggccgtttcagcagtcctgcacgtttgctcttccctctgagttagaa
cggagctatcagagatttactgcattttatgccagtcgtcatagtggaagaaaattaaca
tggttgtatcagctgtccaaaggggagttggttaccaactgtttcaaaaacagatacaca
ttacaggcatccacattccagatggcgattttactgcagtacaacacggaagatgcctat
accgtgcagcagctgacagacagtactcaaataaaaatggatatcttggcacaagttcta
cagatacttttgaaatcaaaattgcttgttttggaagatgaaaatgcaaatgttgatgag
gtggagttaaaaccagatactttaataaaactctatcttggttacaaaaacaaaaaatta
agggtaaacatcaatgtgccaatgaagactgaacagaagcaggaacaagaaactacacac
aaaaatatagaggaagataggaaactactgattcaggctgctattgtgagaatcatgaaa
atgaggaaggttctaaaacaccagcaactgcttggagaagtgctaacacagctgtcctca
aggttcaagccacgagttcctgtaattaagaaatgcatcgacattctcattgagaaggag
tacttggaacgtgtagatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system