KEGG   Empidonax traillii (willow flycatcher): 114063899
Entry
114063899         CDS       T05887                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04540  Gap junction
etl04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114063899 (CDK1)
   04114 Oocyte meiosis
    114063899 (CDK1)
   04115 p53 signaling pathway
    114063899 (CDK1)
   04218 Cellular senescence
    114063899 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114063899 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    114063899 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114063899 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114063899 (CDK1)
   03036 Chromosome and associated proteins [BR:etl03036]
    114063899 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114063899 (CDK1)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     114063899 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     114063899 (CDK1)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   114063899 (CDK1)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    114063899 (CDK1)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114063899 (CDK1)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114063899 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 114063899
NCBI-ProteinID: XP_027752268
LinkDB
Position
Unknown
AA seq 302 aa
MDDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELNH
PNIVCLQDVLMQDSRLYLVFEFLSMDLKKYLDSIPSGQYLERSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQIFRIFRALGTPNNEVWPDVESLQDYKNT
FPKWKPVSLETHVKNLDKDGLDLLAKMLIYDPAKRISGKMALNHPYFDDLDKSTLPASLI
KK
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatgattacacaaaaatagagaagattggggaaggtacctatggtgttgtgtataaa
ggtcgtcacaaaaccacaggccaggtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttattaaaagagctgaatcat
cccaatatagtctgtcttcaggatgttcttatgcaggattcaagactgtaccttgtcttt
gaattcctttccatggatctgaagaagtatttggatagtattccatctggccaatatttg
gagcgttcacgtgttaagagttacctgtaccaaatcttgcaaggtattgtcttttgccac
tcaaggagagttctgcacagagacttgaaacctcagaatctcttaatagatgacaaagga
gtgattaaactggcagactttggattggctcgagcctttggaattccagtgcgggtctac
actcatgaagtagtgacgctgtggtaccggtctccagaggtgttgctggggtctgctcgt
tactctactcccgtagatatatggagcataggtaccatatttgctgagctggcaactaaa
aagccacttttccatggggattcagagattgaccagatcttcagaatcttcagagcttta
gggacccccaacaatgaggtatggcctgatgtggaatccctgcaggactataagaacaca
ttcccaaaatggaaacctgtcagtcttgaaacacatgtcaaaaacttggataaagatgga
cttgatctgctggctaaaatgttaatttatgatcctgcaaaaagaatttctggcaaaatg
gccttgaaccatccatattttgatgacttggacaaatccactcttcctgctagtctgatt
aagaaataa

DBGET integrated database retrieval system