KEGG   Empidonax traillii (willow flycatcher): 114064312
Entry
114064312         CDS       T05887                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04140  Autophagy - animal
etl04150  mTOR signaling pathway
etl04218  Cellular senescence
etl04910  Insulin signaling pathway
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    114064312 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114064312 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    114064312 (TSC2)
   04218 Cellular senescence
    114064312 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114064312 (TSC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114064312 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etl01009]
    114064312 (TSC2)
Protein phosphatases and associated proteins [BR:etl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114064312 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 114064312
NCBI-ProteinID: XP_027753039
LinkDB
Position
Unknown
AA seq 1846 aa
MAALGCSSAQIWPQCSAAMAKPQSKDSGLKEKFRNLLGLGTSRGSSKSSEGKQTEFIITA
EILKELSIECGLSNRIRAIGQICEVAKTKKIEEHAVEAIWKVVADMLQPERPAEARHAVL
HLLKSIVQGQGERLGILRAHFFKVIKDYPSNEDLHERLEVFKALTENGRYITYLEEELAD
FVLQWMDVGLTSEFLLVLVNLVKFNSCYLEDYVADMVHKICLLCIQTSSSVDIEISLQVL
DAVVCYNCLPSENLPVFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMED
RAYMADAALLRGAVFFVGMALWGAHRLNSLKNSPTSVLPSFLKAMTCPNAVVSYEIVLSI
TRLIKKYGKELQAVTWDILLDIMERLLQQLQSLESQELKSIVHDLLTTVEELCEQNDFHG
SEERFFELVEKCADQRPESSVLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNESRSAVR
IKVLDVLSFVLSINRQFYEEELINLVVISQLAHIPEDKDHQVRKLATQLLVDLAEGCNTH
HFNSLLDIIEKVAAHSLSSPSELEERDLLSYSASLEDVKTAVLGLLIILQTKLYSLPSSH
AMRVYEMLIQHVQRHYIYSYSLPVASSIRLQVFDFLLMLRADSLHRLGLSNKDGAVRFSP
YCLCDFVEAEKRAADKKPPGTLSPPSGSPSVPSQNATIRIGHLPYSMVFGVLLQCLKQET
DWKVLKLVLNKLPESLRYKVLFLTSPCNIDLLASALSYMLTDKKTTDRLHGTPEGFSRTD
LHLAVVPVLTALISYHNYLDKAKQREIVYCLEHGLIYRCANQCVVALSVCSVEMPDIIIK
ALPVLIVKLTHISATANMAIPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKF
NQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLN
ERPKSSLRLAKNAKQGLNNSPPVKELKEPSAVDAFRSRSISVSEHVVRSRIQTSITSSSL
GSADENSMAQADDNLKTLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTW
LVGNKLVTITTSVGTGTRSLLGLDSGEFQSTAESSSDPVLQVRQTKEAPAKLESQAGQQV
CRSSRNRVRSMSGGHALRVGALDSSGSHFASGSTSQGTQGPPAPAARSEKANPAPQTPLQ
KEKANLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMA
AERFKEHRETALYKSLSVPSSSLATGTAKPSLLQRSNTVASFSSMYQSSCQGKLHRSISW
AESAVVLEEGSAGEMELKEAESPVESPESEDMETSCSEHVLSEERFGKGQESYSRSSSTS
SQEDKSMKSEDLVEGGIPIGREDGRTLEELSFQPSQPLSKSSSSPELQTLQEVLKDANGR
EVTRRLSTEVKSKSQSGNLEGEGLGSWLGRGEDSRGTGSGLDGAGAATSPRSPSGHRPRG
YTISDSAPSRRGKRIERDAFKGRTAASNAEKVPGINPSFVFLQLYHSPFFGDENNKPLLL
PNETFERSVQLLDQIPSYDTHKIAVLYVGEGQSNNEIAILSNEHGSYRYTEFLTGLGKLI
ELKDCQPDKIYLGGLDVCGEDGQFTYCWHDDIMQAIFHIATLMPTKDLDKYRCDKKRHLG
NDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYDCNLVTLQCRKDMEGLVDTSVAKI
ISDKNLPFVARQMALHANMASQVHHSRSNPTDTYPSKWIARLRHIKRLRHRLREETQYQS
PGLPLQLHPSAPSKPPPQVPQDPPPAYETGQRKRLISSVDDFTEFV
NT seq 5541 nt   +upstreamnt  +downstreamnt
atggcagcacttggatgttccagcgctcagatttggcctcagtgctcggcagcaatggca
aagccgcagagcaaagattccggactgaaggagaaattcaggaacctcctggggctggga
acatcccggggaagttccaagtcgtcggagggcaagcagacagagtttatcatcaccgca
gaaatactcaaggaactgagcatagagtgtggattgagtaacaggatacgagcaatcggt
cagatctgtgaagtggcaaaaaccaaaaaaattgaagagcacgcggtggaggcgatctgg
aaggtggtggctgacatgctgcagccggagcgtccggccgaagccagacacgctgtgctt
cacctgctgaagtcgatcgttcaaggacagggtgagagattagggatcctcagagcccac
ttttttaaggttattaaggactatccctccaatgaagacttgcacgagcggctcgaagtg
ttcaaggctctgacggagaatggacgatacatcacctacttagaagaagagctggctgat
tttgtgctgcagtggatggatgttggtttgacttctgagttcctcctggttttagtgaac
ctggtgaaattcaatagctgctatctggaagactatgtagctgacatggtccacaagatc
tgcctcttgtgcattcagacttcatcatctgtggacatagagatttccttgcaagtcctc
gatgcagttgtttgctacaactgcctgccatcagagaacctgcccgtgtttatcatcact
ctgtgccgtaccatcaacgtgaaggagctctgtgagccctgctggaagctcatgcgcaac
cttttgggaactcatttgggacacagtgccatctacaacatgtgcaggatcatggaagac
agagcctacatggcggacgcagcgctgctgagaggggctgtgttcttcgtggggatggct
ctgtggggcgctcaccgcctcaattccctcaagaactcccccacatcggtgctgccttcc
ttcctcaaggccatgacgtgtcccaacgcagttgtgtcgtacgagatagttctgtccata
acgcgcctgataaagaaatacgggaaggagctgcaggccgtgacctgggatatccttttg
gacatcatggagcgcctgctgcagcagctacagagtctggagagccaagaactcaagtcc
attgtacacgatcttttgactacagtggaagaactctgtgaacaaaatgattttcatggt
tctgaagagagattttttgagctggtggaaaaatgtgctgatcagagaccagaatcttct
gtattaaacctgataacatacagagctcagtccatccatcctgccaaagatggctggatt
cacaacctgcagctgttaatggagaggttcttcaggaatgagagtcgtagtgctgttcga
attaaagttctggatgtcctgtcctttgtgctgagtattaacagacagttctacgaggag
gagctgataaacctggtggtgatctctcagctggctcacattccagaggataaagaccac
caggtccgaaaactggccactcagctgctggtggacctggctgagggctgcaacactcac
cacttcaacagcctgctggatatcatagagaaggtggctgcacattctctctcatctcct
tctgaactggaagagagggacttgctgtcgtattcagcttctctggaggatgtcaaaaca
gcagttcttgggctcctgataattcttcagaccaagctgtacagtttgccctccagccac
gccatgcgggtgtacgagatgctgatccagcacgtccagcgccactacatctactcctac
agcctgcctgtggccagcagcatcaggctgcaggtatttgatttcctgctgatgctccga
gctgactccctccaccgcctcggcctttccaacaaggatggagcagtgaggttcagcccc
tactgcctctgtgattttgtagaggcagagaagagggctgctgacaaaaagccccctggc
acactctctcccccttcaggcagccccagcgtgccttcccaaaatgccaccatccggatt
gggcatcttccatactcgatggtctttggtgtcctcctgcagtgcttgaagcaggagaca
gactggaaggtgctgaagttggttctcaacaagttgcccgaatccctccgctataaagtg
ctatttttaacctctccttgtaacatcgacctcctggcctctgcactgagctacatgctc
acagacaagaagaccacggaccggctccacggaaccccagaaggcttttcccgcactgat
ttgcacctggctgtggtcccagtgctgacagcattaatatcttaccataattacctggac
aaagctaaacagcgggagattgtgtattgcctggagcacgggctgatctatcgctgtgcc
aaccagtgtgtggtggcactgtcggtctgcagtgtggagatgcccgacatcatcatcaag
gcactgcctgtcctaatagtcaaattaacccacatttctgctacagccaacatggcaatc
cctctcctagaattcctgtcaactctggccaggctgcctcacctgtacaggaacttcgca
gcagagcagtacgcgagcgtcttcgccatctccctgccctacacaaacccctccaagttt
aaccagtacatcgtttgcctggcccaccacgtgatcgccatgtggttcatccgctgccgc
cttcccttccgaaaggacttcgtcccctacatcaccaagggtttgcgctccaacgtgctc
ctctccttcgatgacacccctgagaaggacagcttcagggctcgcagcacgagcctcaac
gagaggccaaagagtagtttaagactagccaaaaatgcaaagcaaggcttgaataactct
cctccagtgaaagagctgaaagaaccctctgcagttgatgccttccggtcccgcagcatc
agtgtgtctgaacatgtggtccgcagtcggatccagacatccatcaccagctcgagcctg
ggctctgcagatgagaattcaatggctcaggctgatgacaacctaaaaaccctgcacctg
gagctcacggagacctgcctggatatgatggctcgatacgtcttctccaacttcactgca
gtgccaaagaggtctcccgtgggcgagtttctcttggctggagggaggacgaagacgtgg
ctggttggtaacaagctggtgaccatcactacaagtgttggaacagggacaaggtccctg
cttggcctggactctggggagttccaaagcaccgcagaatcaagctcagaccctgttttg
caagtgagacagaccaaagaagctccagccaagctggaatcccaggctgggcagcaggtt
tgcaggagctctcgcaacagagtccgatccatgtcaggtggtcatgccttacgtgttggt
gccttagacagctcaggctcccattttgccagtggctccacctcccaagggacacagggc
cctcctgctcctgcagctcgctcagagaaggcaaatcctgctccacagacgcccctgcag
aaggagaaagcaaacttggctgcctatgtcccactgctgacccagggatgggcagaaatc
ctggtgcgcagacccacaggtaacaccagctggctgatgagtctggagaacccgctcagc
ccgttctcctcagacatcaacaacatgcccctgcaggagctctccaacgccctcatggct
gcagagcgcttcaaggagcaccgggaaacagctctttacaagtccctgtccgtgccctcc
tccagcctggccacgggaacagccaagccctcgctgctgcagcgctccaacacagtggcc
tctttctcttccatgtaccagtccagttgtcaagggaagttgcacaggagcatatcctgg
gcagaatccgccgtggtgctggaggaggggagcgcgggcgagatggagctcaaggaggcc
gagtccccggtggagtctccggagagcgaggacatggagacgtcgtgttcggagcacgtc
ctgagcgaggaaaggtttggtaaaggccaggagtcctacagcaggtcctcctccacctcc
agccaagaagacaagtcaatgaagtcagaggacctggtggagggtggaattcccatcggg
agagaggacggccggacgctggaggagctctccttccagccatcccagccgctcagcaag
tccagctcttcccccgagctgcagacgctgcaggaggtcctcaaggacgcaaatggcaga
gaagtaacgaggaggctgagcacggaagtgaaatccaaatcccagtctgggaacctggaa
ggggaagggctgggcagctggctgggcaggggggaggactccaggggcaccggctcgggc
ttggatggcgccggagccgccacctctccccgctccccctcgggacaccgaccccgggga
tacaccatctccgactctgccccgtccaggagggggaagaggatcgagagagacgccttc
aagggcaggacagcagcttccaacgctgagaaggtccctgggataaaccccagctttgtg
tttttacagttgtaccactccccattctttggtgatgaaaacaacaagcccctcttgttg
ccaaacgagacgtttgagaggtcggtgcagctgctggaccagatcccgtcgtacgacacg
cacaagattgcagtgctctacgtgggggagggccagagcaacaacgagatcgcgatcctg
tccaacgagcacggctcctatcgctacaccgagttcctcacggggctggggaagctcatt
gagctcaaagactgtcagccagacaagatctacctcgggggcctggacgtgtgtggggag
gatggccagtttacctactgctggcacgatgacatcatgcaagccattttccacattgct
accctgatgcccaccaaggatttggataaatatcgctgtgacaagaagaggcacctgggg
aacgattttgtttccatcgtttacaatgattcaggagaggactttaaactgggaacaata
aagggccagttcaattttgtgcatgtgatcatcacacccctggactatgactgcaacctg
gtgacgctgcagtgtcggaaagacatggagggtcttgtggacacgagtgttgccaagatc
atctcggacaagaacctgcccttcgtggcccgtcagatggccctgcacgccaacatggct
tcccaggtccaccacagccgctcaaaccccacggacacctacccctccaagtggatcgcg
aggctgcggcacatcaaaaggctgcggcaccggctccgggaggaaacgcagtaccagagc
cctggcctccccctgcagctgcacccctctgcccccagcaagccccctccccaggtgccc
caggaccccccgcccgcctacgagacggggcagcggaagcggctcatctcctccgtggac
gacttcaccgagttcgtgtag

DBGET integrated database retrieval system