KEGG   Empidonax traillii (willow flycatcher): 114064409
Entry
114064409         CDS       T05887                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04012  ErbB signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114064409 (CDKN1A)
   04068 FoxO signaling pathway
    114064409 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114064409 (CDKN1A)
   04115 p53 signaling pathway
    114064409 (CDKN1A)
   04218 Cellular senescence
    114064409 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114064409
NCBI-ProteinID: XP_027753213
LinkDB
Position
Unknown
AA seq 151 aa
MPVSLSRAGQTPCSSKVCRNLFGPVDHEELQNDFEDKMRQQLQEAQRRWNFDFETETPLE
GPFKWERILLAEQPPQGVHSLVRAVSSSDSRSSLVCKVPSRDCVGRIRPEESQQSSEVYK
AGSTQGLKRGQTTIKDFYSAKRRIVPAKPKP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgcccgtgtcactcagcagggctgggcagacgccctgcagcagcaaagtgtgcaggaac
ctctttggccccgtggaccacgaggagctccagaatgactttgaggacaagatgaggcaa
caactgcaagaagctcagcggcgctggaacttcgacttcgagacggagactcccttggaa
gggccgttcaagtgggagaggatcctcctggctgagcagccaccccagggcgtccacagc
ctggtcagggctgtcagcagcagcgacagcaggagctccttggtctgcaaggtcccctcc
agggactgtgttggcaggattcgccccgaggagtctcagcagagctcggaggtttacaag
gctggctccacacagggcttgaaacgtgggcagaccaccatcaaagacttctacagtgcc
aagaggaggatcgtccctgccaagcccaagccatga

DBGET integrated database retrieval system