KEGG   Empidonax traillii (willow flycatcher): 114064445
Entry
114064445         CDS       T05887                                 

Gene name
TP53I3
Definition
(RefSeq) quinone oxidoreductase PIG3 isoform X1
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114064445 (TP53I3)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     114064445 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N
Other DBs
NCBI-GeneID: 114064445
NCBI-ProteinID: XP_027753285
LinkDB
Position
Unknown
AA seq 340 aa
MFAAYFDCPGGPENLYMKEVMKPNPGEGEVLVKVSASALNRADLLQRRGKYPPPEGASDI
LGLEAAGSVAGLGPGCRGWWKVGDAVMALLSGGGQAQYVAVPEGHLMPIPKDMTFIQAAA
IPEAWLTAFQLLHFVGKVQEGETVLIHAGASGVGMAAIQLVRLAKAIPIVTAGTQEKLKA
TANAGAAAGFNYKSEDFSEKVLEFTQGSGVDIILDCVGGSYWEKNLNCLGTDGRWIIYGL
LSGGEVHGDLLARLLSKRASIHTSLLRSRDKEYKERLVRAFTEDALPYFSGGASPRLQPL
VDSVYPLHKIAEAHRIMEENRNIGKIVIEVPVCFKKGPLL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtttgcagcctattttgattgcccaggaggcccagaaaatctctatatgaaagaagtg
atgaaaccaaatccaggagaaggagaagttcttgtgaaggtctctgccagtgctctgaat
agggcagatttacttcagaggagagggaagtaccctccccccgaaggagcaagtgatatt
ttaggcttagaagcagctggcagtgtggctgggctgggccctggctgcaggggctggtgg
aaggtcggcgatgcagtgatggctctgctctccggaggaggccaagcacagtatgttgca
gttcctgagggccacctgatgccaatccctaaggatatgacttttatccaggctgcagcc
attcctgaagcctggttaacagcatttcagctgctgcattttgtaggtaaagtacaggag
ggcgagacagtgctgatccatgctggagccagtggagttggcatggcagccattcagctg
gtgagactggcaaaagcaattcccatcgtgacagcaggaactcaagagaaactgaaagca
acagcaaacgctggagcagctgcagggttcaactacaagagtgaagattttagtgaaaaa
gtcctggagttcacccaaggttctggagtggatattattttagattgtgttggtggctca
tactgggagaagaatctcaactgtctgggtactgatggccggtggattatttatggacta
ctgagcggaggtgaagtccatggggatttgctggcaaggctgctttccaaaagagccagc
atccacacgagtctattacggtcacgagacaaggagtacaaggagcggctggtgagagcc
ttcacagaggacgctctgccctatttttccggaggggcttccccgcgtctccagccgctc
gtggacagcgtctaccccctgcacaagatcgcagaggcacacaggatcatggaggagaac
aggaacatcggcaaaatcgtcatcgaagtgcccgtttgcttcaagaaagggccgctgctg
tag

KEGG   Empidonax traillii (willow flycatcher): 114064605
Entry
114064605         CDS       T05887                                 

Gene name
EI24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114064605 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 114064605
NCBI-ProteinID: XP_027753616
LinkDB
Position
Unknown
AA seq 341 aa
MADSVRTFLHDLVRGIKDSIWGICTISKLDARIQQKREEQRRRRANSALAQRRFHMEEKK
QENEPRIVSRIFQCCAWNGGVFWLSLFLFYRVFIPVLQSVTAQIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDLVGQLISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEARTPGKTYHFQLRLFSLVVFL
SNRLFHKTVYLQSALSGASSSPSSSSSSSPSPAKHAAAPGH
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggccgacagcgtgagaaccttccttcatgacctcgtcaggggaattaaggactccatc
tggggcatctgcaccatctccaagctggacgcccggatccagcagaaaagggaagagcag
aggcgcaggagagccaacagtgcactggcccagcggaggtttcacatggaagagaagaag
caagagaatgaaccccggatagtgagccggatatttcagtgttgtgcctggaacggaggt
gtcttctggctgagtctcttcttgttctaccgagtgttcatccccgtccttcagtcggtc
acggcgcagatcatcggtgacccgtccttacacggcgatgtctggtcctggctggagttc
atcctcacctccattttcagtgctctctgggtcctgcccctctttgtgctcagtaaggtt
gtcaatgccatctggttccaggacatcgcggacctggcgttcgaggtgtcgggcaggaag
cctcaccccttccccagcgtcagcaaaatcatcgcagacatgctcttcaacctcctgctg
caggcgctcttcctcatccaggggatgatcgtgagcctgttccccatcgacctcgtgggg
cagctgatcagcctcctgcacatgtcgctgctctactcgctctactgcttcgagtaccgc
tggttcaacaaaggaatcgaaatgcaccaacggttgtcaaacatcgagaggaactggccc
tactactttggcttcgggttaccactggcgttcctcacggccatgcagtcctcctacatc
atcagtggttgcctcttttccatccttttccctctcttcatcatcagcgccaacgaagcc
aggacccccggcaaaacctaccacttccagctccgcctcttctccttggtggttttcctc
agcaacagactctttcacaagaccgtttaccttcagtccgccctgagtggtgcttcctcc
tctccttcctcctcgtcatcctcctcgccctcccccgccaaacacgcggccgctccgggg
cactga

DBGET integrated database retrieval system