KEGG   Empidonax traillii (willow flycatcher): 114064599
Entry
114064599         CDS       T05887                                 

Gene name
CHEK1
Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114064599 (CHEK1)
   04115 p53 signaling pathway
    114064599 (CHEK1)
   04218 Cellular senescence
    114064599 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114064599 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etl03400]
    114064599 (CHEK1)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114064599 (CHEK1)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   114064599 (CHEK1)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    114064599 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 114064599
NCBI-ProteinID: XP_027753607
LinkDB
Position
Unknown
AA seq 476 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKIVDMKRAAECPENIKKEICINK
MLSHENVVRFYGHRREGATQYLFLEYCRGGELFDRIEPDVGMPEPEAQRFFQQLIAGVVY
LHSIGITHRDLKPENLLLDERDNLKISDFGLATVFRHNGRERLLNKMCGTLPYVAPELLR
RPEFRAEPVDVWACGIVLTAMLAGELPWDQPSDSCQEYSDWKDRKTYLPPWKKIDSAPLA
LLHKILMESPSARITIPDIQKDRWYTRPLKKDVKRARLSSGGVTDSPSGFSKHIRSDTDF
SPVKAALGEDKASYSTSQPEPGTGGMPWESGAGSIDQLVQGISFSQPACPDHMLLNSQLL
GTPGSSQSPWQRLVKRMTRFFTKLDADGSYRALKEVCEKMSYGCKMSCTNQVTISTTDRR
NNKLIFKVNLVEMESKILVDFRLSKGDGLEFKRHFLKIKAKLSDIVSTQKVWLPGT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggccgtgcccttcgtggaggattgggacctggtgcagacgctgggcgaaggagcctac
ggggaggtgcagctggccgtgaaccgccgcacggaggaggccgtggccgtgaagatcgtg
gacatgaagcgcgcggccgagtgcccggagaacatcaagaaggagatctgcatcaacaag
atgctgagccacgagaacgtcgtgcgcttctacgggcaccggcgggaaggggccacgcag
tacctgttcctggagtattgccgcggcggggagctcttcgaccgcatcgagccagacgtg
gggatgccggagccggaggcgcagcggttcttccagcagctgatcgccggcgtggtgtac
ctgcacagcatcggcatcacccaccgcgacctgaagccggagaacctgctgctggatgag
cgagacaacctgaagatctcggatttcgggctggccacagtattccggcacaacgggcgg
gagcggctcctgaacaagatgtgtgggacactcccctacgtggccccggagctgctgcgg
cgcccggaattccgagcggagcccgtggatgtctgggcctgtggcatcgtgctgacagcc
atgctggcaggagagctgccctgggaccagcccagcgacagctgccaggaatacagcgac
tggaaggacaggaaaacctacctcccgccttggaagaagatcgattcggcccccttggcg
ctgctgcacaagatcctgatggagagcccctcggcgaggatcaccattcccgacatccag
aaggaccggtggtacaccagacccctcaagaaggatgtcaagcgggctcggctctcctcg
ggaggggtcaccgactcccccagcggcttctccaagcacatccgatctgatacggacttt
tccccggtgaaggccgctctgggcgaggacaaggcgagctactccacatcgcagccggag
cccggcacgggcgggatgccctgggagagcggagcggggagcatcgaccagctggtgcag
ggcatcagcttctcacagcccgcctgccccgaccacatgctgctcaacagccagctgctg
ggcacgcccggctcctcccagagcccgtggcagcggctggtgaagcggatgacgcggttc
ttcaccaagctggacgccgacggctcgtaccgcgcgctgaaggaggtgtgtgagaagatg
agctacggctgcaagatgagctgcaccaaccaggtcaccatctcgaccacggacaggagg
aacaacaaactcatcttcaaggtgaacctggtggagatggagagcaagattttggtggac
tttcgcctctccaagggtgatggcctggagttcaagaggcatttcctgaagatcaaggcc
aagctcagcgacatcgtcagtacccagaaagtctggctgcccggcacctga

DBGET integrated database retrieval system