KEGG   Empidonax traillii (willow flycatcher): 114064916
Entry
114064916         CDS       T05887                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04020  Calcium signaling pathway
etl04114  Oocyte meiosis
etl04140  Autophagy - animal
etl04261  Adrenergic signaling in cardiomyocytes
etl04270  Vascular smooth muscle contraction
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04371  Apelin signaling pathway
etl04530  Tight junction
etl04540  Gap junction
etl04910  Insulin signaling pathway
etl04912  GnRH signaling pathway
etl04914  Progesterone-mediated oocyte maturation
etl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114064916 (PRKACB)
   04310 Wnt signaling pathway
    114064916 (PRKACB)
   04340 Hedgehog signaling pathway
    114064916 (PRKACB)
   04371 Apelin signaling pathway
    114064916 (PRKACB)
   04020 Calcium signaling pathway
    114064916 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114064916 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114064916 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114064916 (PRKACB)
   04540 Gap junction
    114064916 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114064916 (PRKACB)
   04912 GnRH signaling pathway
    114064916 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    114064916 (PRKACB)
   04916 Melanogenesis
    114064916 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114064916 (PRKACB)
   04270 Vascular smooth muscle contraction
    114064916 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114064916 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etl03019]
    114064916 (PRKACB)
   03036 Chromosome and associated proteins [BR:etl03036]
    114064916 (PRKACB)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114064916 (PRKACB)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: AGC group
  PKA family
   114064916 (PRKACB)
Messenger RNA biogenesis [BR:etl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114064916 (PRKACB)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114064916 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like VSG_B
Other DBs
NCBI-GeneID: 114064916
NCBI-ProteinID: XP_027754172
LinkDB
Position
Unknown
AA seq 403 aa
MSWHPGRAAAPDPDRKAAWSPRRYLVLTWIYKWLCKMHSKNGAQEQKGTQESESQRCSEF
TARWDESMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQ
YYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagctggcatccagggagggctgcagctccagatcctgacaggaaagcagcctggtca
cctcgtagatacctggtgctcacctggatttacaaatggctatgtaagatgcactccaag
aatggtgcccaggagcagaaagggacgcaggaaagtgagagccaacggtgctctgagttc
actgcccggtgggatgaatcgatgaaagagttcctagccaaagccaaagaagacttttta
agaaaatgggaaagcccccctcagaatactgctggcctagatgattttgagaggcaaaaa
acccttggaacaggatcatttgggagagtaatgatggtgaaacataaatccacagaacag
tattatgctatgaagatactggacaaacagaaggttgtcaaactgaagcagatagaacac
acactgaatgagaagagaatattacaagcggtgaactttcctttccttgttaaactggag
tattcttttaaggacaattctaatttatacatggtaatggagtatgttcctggtggtgaa
atgttttcacatctaagaagaatcggaaggttcagtgaaccacatgcacggttttatgca
gctcagatagtgctaacatttgagtacctccattcattagacctcatctacagagatcta
aagcctgaaaatcttttaattgatcagcaaggatacatccaggtcacggactttggcttt
gcaaaaagagtaaaaggaagaacttggacgttatgtgggactccagaatacctggcacct
gaaataattctcagcaagggttacaacaaggcagtggattggtgggcattaggagtgtta
atctatgaaatggcagctggatatcccccattctttgcagatcagcccattcaaatttac
gagaagattgtgtccggcaaggtgaggtttccatcacacttcagttcagacctaaaggat
cttctaagaaatttactccaggtagatttgaccaaacgatatggaaatctcaagaatggt
gtaaatgacataaagaatcacaagtggtttgcaactacagattggattgccatttatcag
agaaaggtagaagctccattcataccaaagtgcagaggtcctggagataccagcaacttc
gatgactatgaagaagaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaattt
gctgatttttag

DBGET integrated database retrieval system