KEGG   Empidonax traillii (willow flycatcher): 114065277
Entry
114065277         CDS       T05887                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114065277 (APAF1)
   04115 p53 signaling pathway
    114065277 (APAF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114065277 (APAF1)
   05168 Herpes simplex virus 1 infection
    114065277 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD eIF2A CARD_2 Ge1_WD40 WD40_like AAA_16 AAA_22 DUF2415
Other DBs
NCBI-GeneID: 114065277
NCBI-ProteinID: XP_027754846
LinkDB
Position
Unknown
AA seq 1249 aa
MDVKSRNYLLMNRQALEKDIKTSYIMDHMISDEVLTLQEEERVKQQNTQKERAAMLINII
LTKDNNSYRSFYNALLHEGYRDLAALLQDGIPAVSSGNRKSSMDGMTSYVKTVLCEGGVP
QRPVVFVTRPKLVDAIKKKLSCLGSDPGWVTVYGMAGCGKTVLTAEALRDHQLLEDYFPG
GVHWISVGKQDKAGLLIKLQNLCSRLEHDSTLSQRSPLNIEEAKDRLRLLMLRKYPRSLL
VLDDIWDSWVLKAFDNQCQVLITSRDRSVTDAVTGNKFEVHVESGLAHEKGLEILSLFVN
MKISELPEQANSLVRECKGSPLVISLIGALLRDFPSRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEQLNDNCKDYYKDLSILPKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFHYYLHDLQLDFLTEKNRNQLQELHKNIVNQYKKYYKLKTPVPSQEDC
MYWYNFLAYHMAGANMQEELRDLMFSLDWIKAKTELVGPAHLIHEYVEYSSILDQKDSTV
RENFQEFLSLNGHLLGRQPFPDIIQLGLCQPETSEVYQQAKLHAQRETGTFYLEWINKKS
LKNLYRLVVRPHRDAVYHACFSKDRQRIASCGADKTLQVFKAESGERLLEINAHDDEILC
CAFSADGEFVATCSSDKKVKIWNSRTGQCWRVYEEHSEQVNCCQFNNRRGQYLLATCSND
TFIKLWDVNEKYCRNTMIGHENSVNHCRFSPNDEYVASCSTDGTVKLWAACSGNELKSIE
IKDFFKNADEQPDDVDVLVKCCSWSRNGDMILVVAKNKLLLFDTETCDLVTEVIISHHST
IQYCDFCPGDELVAVALSHCSVELWNIKSLSKVAYCRGHMSWVHCVAFSPDGSLFLTSSD
DQTIRIWETKKVCKSSDDVLKSELDVVFHNGEVMILAIYNQKHLQLINGNTDNVIMQTAA
QESPISCCCLSKDLKFAAFGQESGTIKVLQLSDGKVLKSWEAYRTSVQHCQFTSDCQTLI
SSAHDSVLQVWNWELSEHVFLRGHMEAIKDFRLLENSKLLSWSFDGTVKVWNITTGNLEK
DFACHGGAVLSCAVSPDGSKFSSTSADKTAKIWSFESSAVLHELKGHEACVRCCTFSPNN
KLLATGDDKGEIRIWDVLAGALLHFCSPVTVDEGEPTHGGWVTDLSFSSDSKMLVSSGGY
LKWWNVTTGESLQTFYTNGTNLKSIHVSPNFKVYVTVDNLGILYILQKF
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgtcaagagtagaaattatttacttatgaatcgccaagcactggaaaaagacatc
aagacttcctatattatggatcatatgatttctgatgaagtgctaacattacaagaggaa
gagagagtgaaacagcagaacacacagaaggagcgagcagccatgctaataaatattatt
cttacaaaagataataattcatatagatccttttataatgcactgcttcacgaagggtac
agagatcttgctgcgcttcttcaggatggcatccctgctgtctcgtctggtaacagaaag
agttcaatggatggaatgacttcatatgtgaagacagttctctgcgaaggaggtgtacca
cagagaccagttgtgtttgtcactcggccgaaactggtagatgctattaaaaagaagctg
tcctgcttgggaagtgatccaggctgggtcacagtttatggaatggcaggctgtgggaag
actgttttaacagcagaagctttaagggatcatcagctcttggaagattactttccagga
ggagttcactggatctctgttggaaagcaagacaaagcaggcctcctaataaaacttcag
aatctctgtagtaggttagaacatgactcgactctttcacagaggtcaccacttaacatt
gaggaggctaaagatcgtcttcgtttgctgatgttacgcaaatatcccagatctcttttg
gtcctggatgacatttgggattcctgggtactgaaagcattcgataatcagtgtcaggtt
cttatcaccagcagggacaggagcgtaacagatgctgtgactggcaataaatttgaggtt
catgtcgagagtggactagcacatgagaaaggactggagattttatccctgtttgtgaat
atgaaaatatcagaactgccagaacaagctaactctcttgtaagagaatgcaaaggttct
cctcttgtgatatccttgataggtgcattattacgagacttccctagtcgttgggaatac
tatctcagacagctgcagaataagcagtttaaaagaataagaaaatcttcatcttatgat
tacgaagcccttgatgaagcaatgtccataagtgttgagcaactaaatgacaattgcaaa
gactactataaagacctctctattctccctaaagatgttaaagtaccgactaaggttctc
tgtattctttgggatatggaaactgaagaagttgaagatatactgcaggaatttgttaac
aaatcactcttgttctgtgatcgtaacgggaagtcattccattattatctacatgatctt
caacttgactttctcacagagaagaatcgcaaccaacttcaggagctacataaaaacata
gtaaatcagtacaagaaatattacaaactgaagacgcctgttccatcccaagaggactgc
atgtactggtataacttcctagcgtatcacatggctggtgccaacatgcaggaggagctc
cgtgatcttatgttttctttagattggattaaagctaaaacagaattagtagggcctgct
catctgattcatgaatatgtagaatatagttcaatcctggatcaaaaggatagcacagta
cgtgagaacttccaggaatttctctctttaaatgggcatcttcttggacggcagccattt
cctgacattatacagctgggactttgccaaccagaaacatcagaggtatatcaacaagcc
aagctacatgctcaaagagaaacaggaacattttatttggagtggataaataaaaaatcc
ttgaaaaacctctaccgtctagttgttcgtccacacagagatgcagtttaccatgcctgc
ttttctaaggatagacaaaggatagcatcatgtggagcagataaaacacttcaggtgttt
aaagcagaaagtggagagagactcctggagataaatgcccacgatgatgaaatactttgt
tgcgctttctctgcagatggtgaatttgtagcaacctgttcaagtgataaaaaagtgaag
atctggaactcaagaacaggccagtgttggcgtgtatacgaagaacactcagagcaggtc
aattgctgccagttcaataacagaaggggtcagtatctcctagccacctgctcaaatgac
actttcatcaaactttgggatgtgaatgaaaagtattgtagaaatacgatgataggtcat
gaaaattctgtcaatcactgtagattttcaccaaatgatgaatatgttgctagctgctca
acagatggaacagtaaagctttgggcagcatgctcaggaaatgaactgaaaagtattgag
ataaaagatttcttcaaaaatgcagatgagcaaccagatgatgtggacgtcttagtaaaa
tgttgctcttggtccagaaatggtgacatgattttggtagtagccaaaaataagcttttg
ctttttgatactgaaacatgtgatttggtaacggaagtcatcatcagtcatcacagtaca
atccaatactgcgacttttgtcctggtgatgagttagtagcagttgccttgtctcactgt
tctgttgagttgtggaatattaaatctctgtcaaaagtggcatattgcaggggacacatg
agctgggttcactgtgtggcattttcaccggatggatctttatttctgacatcatctgat
gaccagacaatacgcatctgggaaacaaagaaggtgtgcaagtcttctgatgatgtgctg
aaaagtgaactagatgttgtatttcacaatggtgaagtgatgattttagccatttataat
cagaagcacttacaacttatcaatggaaatacagacaatgttattatgcagacagcagcc
caagaatcccccatttcctgctgttgcttaagcaaagatcttaaatttgcagcttttgga
caggaaagtggaacaataaaggtactacagttgtcagatgggaaagttctgaagtcctgg
gaggcctacaggacatctgtgcagcattgtcaattcacatctgattgtcagactctcatt
tcaagtgctcacgattcagttctacaggtatggaattgggagttgagcgaacatgtgttt
ctaagagggcacatggaagcaatcaaggattttagacttctggaaaattcaaaacttctc
tcttggtcatttgatggaactgttaaggtttggaatatcacaactggaaacctagaaaaa
gattttgcttgtcatggaggtgctgtgctttcctgtgctgtttcacctgatggtagtaaa
ttttcatctacttctgctgacaaaactgcaaagatatggagctttgaaagctctgctgtt
cttcatgagctgaaaggtcatgaagcctgtgtgcggtgctgtactttctctcctaacaac
aaattattggccactggagatgacaaaggagaaataaggatttgggacgttttagcaggt
gcattacttcacttctgctccccagttactgtagacgaaggagaaccaactcacgggggt
tgggtaacagacctctcattttcttctgatagtaaaatgcttgtgtcatctggaggctat
cttaagtggtggaatgtaactactggagaatccttacaaaccttctacacaaatggaaca
aacctcaagtcaatacatgtgtctcctaatttcaaagtgtatgtgactgttgataatctt
ggtattctttatatattacagaaattctga

DBGET integrated database retrieval system