KEGG   Empidonax traillii (willow flycatcher): 114065315
Entry
114065315         CDS       T05887                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04140  Autophagy - animal
etl04141  Protein processing in endoplasmic reticulum
etl04210  Apoptosis
etl04217  Necroptosis
etl04261  Adrenergic signaling in cardiomyocytes
etl04340  Hedgehog signaling pathway
etl04510  Focal adhesion
etl04621  NOD-like receptor signaling pathway
etl05132  Salmonella infection
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114065315 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114065315 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114065315 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    114065315 (BCL2)
   04217 Necroptosis
    114065315 (BCL2)
   04115 p53 signaling pathway
    114065315 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114065315 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114065315 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114065315 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114065315 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114065315 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etl01009]
    114065315 (BCL2)
Protein phosphatases and associated proteins [BR:etl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114065315 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 114065315
NCBI-ProteinID: XP_027754922
LinkDB
Position
Unknown
AA seq 239 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDPAPLPPGLSPPAAAAVAAAAGTSSD
HTGLVSPHPEPPGSAAASHAPLAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLH
LTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAAWMTEY
LNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctcatccggggagaagaggctacgataaccgggagatagtgctgaagtacatccac
tataaactctcgcagaggggatacgactgggctgccggtgaggacccggcacccttgcct
ccaggtctctctcctcctgctgctgctgcggttgctgctgctgctgggacttcctctgat
cacactgggctggtctctccgcaccccgagccccctggctcggctgctgctagccacgca
cccctggccgaggggctgcgccccgcaccccaggttgtccacctcgtcctgcgccaggca
ggggacgagttttcccgccgctaccagagggactttgcccaaatgtctggccagctgcac
ctgacgcccttcacggccaggagccgcttcgtggcggtggtggaggagctcttccgagat
ggggttaactggggcagaattgtggccttcttcgagttcggcggtgtgatgtgtgtggag
agcgtcaaccgggagatgtctccccttgtagacaacattgctgcctggatgactgagtac
ctgaaccggcacctgcacaactggatccaggacaacggaggctgggatgcctttgtggag
ttgtatggcaacagtatgaggcctttgttcgatttctcctggatctctctgaagactatc
ctgagtctggttctggtgggagcttgcatcactcttggcgcttatctcggacataagtag

DBGET integrated database retrieval system