KEGG   Empidonax traillii (willow flycatcher): 114065317
Entry
114065317         CDS       T05887                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5
  KO
K10139  serpin B5
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114065317 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114065317 (SERPINB5)
Peptidases and inhibitors [BR:etl01002]
 Peptidase inhibitors
  Family I4: serpin family
   114065317 (SERPINB5)
SSDB
Motif
Pfam: Serpin Toprim_Crpt
Other DBs
NCBI-GeneID: 114065317
NCBI-ProteinID: XP_027754925
LinkDB
Position
Unknown
AA seq 377 aa
MTMDALQLANTAFAVDMFKKLCEKDKTANIIFSPLCTSTSLALAYKATKGDTADQMKQVL
HLKDVKDVSFGFQTITSDVSKLSSFFALKMVKRLFVDKSLNPTTDFVNSTKRPFPSELEL
VEFKEKTEETRQKINKSLSELTDGKMENILNEDSVSGETQILLVNAAYFVTNWMKKFPEA
EIKECPFKVNKTETKPVQMMNLEATFCLGYVKDLNVSILELPCLNKHISMLILLPKEIED
DTTGLEQLEKALTPETLLQWTNPSMMANTKVNVFLPKFSIEGDYDLKPLLQSLGMTNIFN
ESASDFSEMCETKGVVLSKIIHKVSLEVNEQGGDSREVPGYRILQHKDEFKADHPFIFLF
RHNKTRNVILTGRFCSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgacaatggacgctctgcaattagcgaacactgcctttgcggttgatatgttcaaaaaa
ctatgtgagaaggacaaaacagccaatattattttttccccactgtgtacctcaacttct
ctggctctggcgtataaagctacgaaaggtgatactgcagaccaaatgaaacaggtactc
catttaaaagatgtcaaagatgtttcttttgggtttcaaacaataacttcagatgtttcc
aaactcagctctttctttgcactgaaaatggtcaaacggctgtttgtggacaagtctctt
aatcctaccacagactttgtcaactccacaaagaggccttttccatctgaactggaatta
gtggagttcaaagaaaaaacagaggaaacccgacaaaaaatcaacaaatctctttcagag
ctaactgatggcaaaatggagaatattttgaatgaggatagtgtaagtggcgagactcag
atccttctagttaatgctgcttattttgtcacaaactggatgaagaagttcccggaggca
gagatcaaagaatgtccttttaaagtcaacaagactgaaacgaaaccagtgcagatgatg
aatctggaagctactttttgcctgggatatgtaaaagatttaaatgtttccatccttgag
cttccatgccttaacaaacatataagcatgctcattctgctgcccaaagaaattgaagat
gacaccactggcttggagcagctggaaaaggcactgactcctgagacattattacagtgg
accaatcccagcatgatggccaacaccaaagtgaatgtatttcttccaaagtttagcata
gaaggtgactacgacctgaagccacttctgcaaagcctgggaatgacaaatatcttcaat
gaaagtgcatcagatttctctgagatgtgtgagacaaaaggtgtggttttgtcaaagatc
atccataaagtctccttggaagtaaatgaacaaggtggcgactcccgagaggtaccagga
tatcggattctgcaacacaaagatgaatttaaagctgaccatccatttatctttttgttt
agacataacaaaactcgcaatgtgattctcacaggccgtttctgttctccctaa

DBGET integrated database retrieval system