KEGG   Empidonax traillii (willow flycatcher): 114065385
Entry
114065385         CDS       T05887                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5 isoform X1
  KO
K14289  exportin-5
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03013  RNA transport
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114065385 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etl03016]
    114065385 (XPO5)
   03036 Chromosome and associated proteins [BR:etl03036]
    114065385 (XPO5)
Transfer RNA biogenesis [BR:etl03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    114065385 (XPO5)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     114065385 (XPO5)
SSDB
Motif
Pfam: Xpo1 IBN_N HOOK_N
Other DBs
NCBI-GeneID: 114065385
NCBI-ProteinID: XP_027755073
LinkDB
Position
Unknown
AA seq 1213 aa
MSAEQVSGLCEQLVKAVTVIMDPASTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQT
AIVRHFGLQILEHVVKYRWNNMPRLEKVYLKNNVMGLISSGTQSILEEESHIKDVLSRIV
VEMIKREWPQHWPDMLKELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPTQRRRDIQQ
TLTQNMEKIFSFLVTALQQNVNKYRCMVGAPQEQEVLTTPQKTDLAQEPKAQANCRVGIA
ALNTLAGYIDWVALSHITADNCKLLEMLCLLLNEPELQVGAAECLLIAVSRKGKLEDRKP
LMVLFGDVAMHCILSAAQTADGEGLVEKHYVFLKRLCQVLCALGSQLCALLGSYCDVETP
ANFGKYLESFLAFTTHPSQFLRSSTQVTWGALFRHEVLSRDPLLLAIIPRYLHASMTSLV
KVGFPSKTDSPICEYSRFDFDSDEDFNAFFNSFRAQQGEVMRMACRLDPRTGFQMAGEWL
KYQLTAPVDTGPMNSKTGEGLCSIFSPSFVQWDAMTFFSESIISQMFRTMDKDEIPVNDG
IELLQLVLNFETKDPLILSCVLTNVSALFPFVTYRPEYLPQVLSKLFASVTFEVTEESKA
PRTRAVKNVRRHACSSIIKMCRDYPQLVLPNFEMLYNHVKQLLSNELLLTQMEKCALMEA
LVLISNQFKDYERQKAFLEELMAPVAGLWLSPEMQRVLADPEAFISYVGADNKTADPVLE
DRSGLNRSRISFCVSTILGVVKRARWPAAIEEAKAGGFFLGYLPSGTPIYRNPCTEQVLK
LFDNLLALIRTHNNLYMPEIMARLGDTFAKALDMLEVEKNAILGLPQPLLELYDSPVYKT
VLERMQGFFCTLYDNCFHILGNAGPSMQQDFYTVEGLATQLLSSAFNNLNNIPDYRLRPM
LRVFVKPLVLSCPSEYYETLVCPMLGPLFTYLHMRLSQKWQVISQRTMLCEDDAADDNPE
SQEMLEEQLVRLLTREVMDLVTVCCVSKKNVEHNTTAAVDGDDDEAMATEVTPPASAELT
ELGKCLMKQEDVCTAVLITAYTSLSWKDTLSCQRTTTQLCWPLLKQVLPGNLLPDAVSWF
FTSVLRGLQVHGQHDGCMAALVNLAFQIYEALRPRYAELKAVMEQIPDIQLDSLEQFDSK
LLNPTLQKVADKRRKDHFKRLITGCIGKPIGEQFRKEVHIRNLPSLFKKVKPSLETDVLE
NEDGEGFNVLFEP
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgtccgccgagcaggtgagcggcctctgcgagcagctggtgaaggccgtgaccgtcatc
atggaccccgcgtccacgcagcgctaccgcctggaggccctcaagttctgcgaggagttc
aaggagaagtgccccatctgcgtgccctgcgggctgaagctggcggagaagacgcagacg
gccatcgtccggcacttcggcctgcagatcctggagcatgtggtcaaataccgctggaac
aatatgcctcgcctagaaaaagtttatctaaagaacaatgtcatgggcctcatatccagt
ggaactcaaagtatcctggaggaggaaagtcacatcaaggatgttctgtctcgcattgtg
gtggagatgatcaagcgtgaatggcctcagcactggcctgacatgctaaaggagctggat
accctctccaagcaaggggaaacccagacagaactggtgatgttcatcctcctacgtttg
gcagaggatgtggtgacttttcaaactctgcctacccagcggcgacgagacatccagcaa
accctcacccaaaacatggagaagatcttcagcttcctagtaactgccctgcagcagaac
gtcaacaagtacagatgcatggttggagcaccccaggaacaagaagtcctcaccactcca
cagaagactgatctggctcaggaaccaaaggcccaggcaaactgccgtgtggggatagca
gcactcaacactttggctggctacattgactgggtagccctaagccatatcacagcagac
aactgcaagctcttggagatgttgtgtctactcctaaatgagcctgaactccaagtcgga
gcagcagagtgtcttctgattgctgtcagcaggaaaggtaagctggaggatcggaagcct
ctcatggtcttgtttggagacgttgccatgcactgcattctctccgctgcccagacagca
gatggagaaggcctggtggagaagcactatgttttcttgaagagactttgccaagttttg
tgtgcgttgggcagccagctatgtgcgttgctaggctcatattgtgatgtggaaacacca
gccaactttggaaaataccttgagtcatttttagccttcacaacccatcccagccagttt
ctgcgctcttccacccaggtcacgtggggggccctgttccggcatgaagttctgtcccgt
gaccccttattgctggctatcattcccaggtatctccatgcatctatgaccagcctagtg
aaggtgggctttccctctaaaacagacagccccatttgtgaatactcccgctttgatttt
gacagcgatgaggacttcaatgccttcttcaactctttccgagcccaacaaggagaggtg
atgaggatggcttgtcgtctggaccctcgaactggcttccaaatggctggagaatggctg
aagtaccagctcacagctcctgttgatactggacccatgaactctaagactggcgaaggt
ctctgctccatcttttccccatcgtttgtgcagtgggatgccatgaccttcttctcggag
agcatcatcagccagatgtttcgaaccatggataaagatgaaatcccagtcaatgatggc
atagagctgctgcagcttgtccttaattttgaaacaaaagatcctctcatcctgtcctgt
gtgctcaccaatgtctctgctctctttccatttgtgacttaccgaccggaatacctgccc
caagtactttccaagctgtttgcttcagttacctttgaagttacagaagaaagtaaggct
cctagaactcgagcagtgaagaatgtgagaaggcatgcatgctcctcaatcataaagatg
tgtcgggattaccctcaacttgtcctgccaaactttgagatgttgtacaaccacgtgaag
cagctgctctccaatgagctacttctgacacagatggagaaatgtgctcttatggaggcc
cttgtcctcatcagcaaccagtttaaggactatgagcgacagaaggctttcctggaggag
ctcatggctcctgttgctggcttatggctctccccagagatgcagagagtcctcgcggat
cctgaagcctttatctcctatgtgggtgcagacaacaaaactgccgatccagtcctggaa
gaccgcagtggcctgaaccgctctagaataagcttttgcgtgtccacaattctgggagtt
gtgaagcgagctcgctggcctgctgctatcgaggaggcaaaagctggaggattcttcttg
ggatacctgcccagcggaactccaatctaccgtaacccctgcacggagcaggtcctgaag
ctttttgacaatttacttgctctcataaggactcacaacaatctctacatgccagagata
atggctaggctgggggatacgtttgcaaaggccttggacatgctggaggtggagaagaat
gccattctaggtctccctcagcctttgctggagctttatgactctcctgtttacaaaaca
gtcttagaaaggatgcagggcttcttttgtaccctctacgacaactgttttcacatcctg
ggaaatgcaggcccctccatgcaacaggatttttacactgttgagggtctcgccacccag
ctccttagctctgctttcaacaacctcaacaacattcccgattacagactgcgtcccatg
ctccgtgtgtttgtgaagcccttggtactctcctgcccttcagaatactacgaaaccctt
gtctgtcccatgctgggaccactctttacctatctgcacatgaggttatcccagaaatgg
caggtgatcagtcagcgaaccatgctctgtgaggatgatgctgcagatgacaaccccgag
tctcaggagatgcttgaggaacagctggtcaggctgctgacccgagaagtcatggatctc
gtcactgtttgctgtgtttctaagaaaaatgttgaacataacactactgctgctgtagat
ggagacgatgacgaggccatggccacggaggtgaccccccctgccagcgcagagctcact
gagctcggcaagtgtctgatgaagcaagaggatgtttgcactgcagtgctgatcactgcc
tacacatccctctcctggaaggacaccttgtcctgccaaagaaccacaacacagctttgc
tggccactgcttaaacaggtgcttccaggaaacctcctgcctgatgccgtgtcctggttt
ttcacaagtgtgctgaggggcttacaggtacacgggcagcacgatggctgcatggcagct
cttgtcaacctggctttccagatctacgaggccttgcgccctcgctatgctgagctgaag
gcagtgatggagcagatcccagatatccagctggactctttggagcagtttgattcaaag
ctcctcaacccaacgctgcagaaggtggcagacaagcgccggaaggatcacttcaagcgc
ctcatcacaggttgcattgggaaacccattggggagcagttccgcaaggaggttcatatc
cggaaccttccatctctcttcaaaaaggtgaagccatcattggagacagatgtgctagaa
aacgaggatggagagggcttcaatgtactctttgaaccctga

DBGET integrated database retrieval system