KEGG   Empidonax traillii (willow flycatcher): 114065893
Entry
114065893         CDS       T05887                                 

Gene name
ADGRB1
Definition
(RefSeq) adhesion G protein-coupled receptor B1 isoform X1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114065893 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114065893 (ADGRB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114065893 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114065893 (ADGRB1)
Peptidases and inhibitors [BR:etl01002]
 Mixed peptidases
  Family P2
   114065893 (ADGRB1)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Phagocytosis
   Others
    114065893 (ADGRB1)
G protein-coupled receptors [BR:etl04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   114065893 (ADGRB1)
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS TSP1_CCN
Other DBs
NCBI-GeneID: 114065893
NCBI-ProteinID: XP_027755924
LinkDB
Position
Unknown
AA seq 1629 aa
MRSIGSALNLLLVSPLYFVWTVVALDLAQTPCTTLVQGKFFGYFSSFAVFPLNSSLCSWI
IQNPDPRRYTLYMKILKPAGVCDHQHIRTYQFDSFLESTRTYLGMESFDDVLKLCDGSTR
FAFLQSNKQFLQMKQTAPPGVETWPARWKPTKAQERDFSVEYLVVGNRNPSKAACQMLCK
WLDACLAISSSSHPCGIMQTPCSCSGGEALDQASEVLGFTRKKEDCYKDGIYLENCVSSP
KDANGAEFLGGWNSWSAWGDCTKDCGGGLQTRMRSCKPLPKEGLGCEGVLEEGRLCNRKA
CNTNGRYNSRSQSLRSTDNRKREDPDDLQHYGYPAPQIGDPAAEEWSPWSVCSTTCGEGW
QTRTRFCVSSSYSTQCSGPLREQRQCNNSAVCPVHGTWDEWSPWSLCSSTCGRGYRDRTR
TCKPPQFGGNPCEGPEKQTKFCNIALCPGHSVDGNWNEWSSWSSCSASCSNGTQQRTREC
NGPSYGGAECQGHWVETRDCFLRQCPVDGKWQAWGVWGSCTATCGGGTQRRDRVCYGPFF
GGETCQGPKEEYKQCNDRKCPEPHEICDEESLGSVVWKETPAGDAAAVRCPRNATGLILR
RCILDEEGIAYWEPPTYIKCVSIDYRNIQMMTREHLAKAQRGLLGDGLSDVLQNLVEISQ
DGTSYSGDLLSTMDVLRNVTEIFRRAYHSPTSGDVQNFVQILSNLLSEENREKWEEAQLI
GPNAKELFRLVEDFIDVIGFRMKDFRDSYQVTDNLVLGIHKLPANAATDITFPMKGWRGM
VDWAKNSEDKVTVSKSILSSGLSVSDDSSVFVVGTVLYRNVGNILSLQRNSTVLNSKVIS
VTVKPFPRSLLTPLEIEFSHLYNGTTNQTCILWDENDGRASASASPPGAWSWRGCRTVPL
DASRTKCLCDRLSAFAILAQLSPDMNMEKVLVPSVTLIVGCGVSSLTLLLLIIIYVSVWR
TQVFPCLGYHWMCSSPCPLLLFLRLGSTEQRWYIRSERSVILINFCLSIISSNALILIGQ
TQTRNKVICTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPA
LVVAISVGFTKAKGYGTVNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDG
ITDKKLKERAGQMAVPLYGMTLKCSKCGVVSSAEVSATATSNAMASLWSSCVVLPLLALT
WMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGD
SGGSFQNGHAQLMTDFEKDVDMACRSGEHITVLNKDITTCRTSTITGTLKRPSLPDEEKL
KLNHQKVSSNFNSLPANVSKMHLQGSPHYLGAINLNEFSNHSLTLKKDKNQPPKSIYICD
GDIFKKLDSELSRAQEQTLDTSYVILPTNTSTLRAKPKDESKYSINIDQMPQTRLIHLSM
ATDPGFVVKSPPREPVAMACSEAQGSSMIQQQQQLAPQSISNESQIPNSLCDTGDSGNSG
VVSKSETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAEKDKESPT
TDSKQEKQQTPNKRPWEGIRKVQSPPSWVKKDMEPVAQSPLELKTVEWEKTGATIPLVGQ
DIIDLQTEV
NT seq 4890 nt   +upstreamnt  +downstreamnt
atgaggagcattggatctgccctgaacctgcttttggtgtctccactctactttgtgtgg
accgtggtcgctctggacctggcacaaactccctgcaccactttggtccaagggaaattc
tttgggtacttctcctccttcgccgtcttcccgctgaactcgtccctgtgctcctggatt
atccagaaccccgacccccgcaggtacactttgtacatgaagatcctcaagcccgccggc
gtatgtgaccaccagcacatccgcacctaccagttcgactccttcctggagtccacccgc
acctacctgggcatggagagcttcgacgacgtgctgaagctctgcgacggctccacgcgc
ttcgccttcctccagtccaacaagcagttcctgcagatgaagcagacggcccctccgggg
gtggagacctggcccgccaggtggaagcccaccaaagcccaggagagggacttctcggtg
gagtacctggtggtgggcaacaggaaccccagcaaagccgcctgccagatgctctgcaag
tggctggacgcctgcctggccatcagcagcagctcccacccctgcggcatcatgcagacc
ccctgctcgtgctcgggaggggaggccctggatcaggccagcgaggtcctggggttcacc
aggaagaaggaggattgctacaaggatgggatttacttggagaactgcgtgagcagccct
aaggacgccaacggagcggagttcctgggtggttggaactcgtggtcggcttggggcgac
tgcaccaaggactgcgggggaggcctccagacccgcatgcgctcctgcaaaccccttccc
aaggagggcctcggctgcgagggagtcctggaggagggccggctgtgcaataggaaggcg
tgcaataccaatggacgctataattccagaagccaatcgctgaggtccacagataacaga
aagcgagaggaccctgacgatctgcagcactacgggtaccctgcacctcaaataggtgac
cctgcagcagaggagtggtccccctggagcgtgtgctcgaccacctgcggggagggctgg
cagaccaggaccaggttctgcgtgtcgtcttcctacagcacccagtgcagcggccccctc
cgggagcagaggcagtgcaacaactctgccgtgtgcccagttcacggcacctgggacgag
tggtctccgtggagcctgtgctcctccacgtgtgggagaggctacagggaccggacccgc
acctgcaaacccccccagttcggcggcaacccctgcgagggccccgagaagcaaaccaag
ttctgcaacatcgcgctctgcccaggccactcagtggacggcaactggaacgagtggtcg
agctggagctcctgctccgcctcctgctccaacgggacccagcagaggaccagggagtgc
aacgggccctcctacggcggagccgagtgccagggacactgggtggagaccagggactgc
ttcctgcgccagtgcccagtggatgggaagtggcaggcctggggagtgtggggcagctgc
accgccacgtgtgggggtggaactcagcgacgtgaccgtgtgtgctacggacctttcttc
ggtggagagacttgccagggtcccaaggaggagtacaagcagtgcaacgacagaaagtgt
cctgagccccatgaaatctgtgacgaggaaagccttggctctgtggtttggaaggaaact
ccagctggggatgctgccgctgtccggtgtccccgcaatgccactgggctcatccttcga
aggtgcattttagatgaggaaggcatcgcttactgggagcccccaacgtacatcaagtgt
gtttctattgattacaggaacatacagatgatgaccagggaacatcttgccaaggctcag
cgtgggctgctgggagatgggctgtcagatgtgctccagaacctggtggaaatctcccag
gacgggaccagctacagcggggacttgctgtccaccatggacgtactcaggaacgtgaca
gagatcttccgcagggcttatcacagcccgacctctggggatgtccagaactttgtccag
atcctcagcaaccttttgtcagaggaaaaccgggagaaatgggaggaagctcagctgata
gggccaaatgccaaggagctgttcaggctcgtggaggatttcattgatgtcattggcttc
cgcatgaaggatttccgggattcctaccaagtgacggacaatctggtcctcggcatccac
aaactgcctgcgaacgcagcgaccgacatcaccttccccatgaaaggctggagaggcatg
gtggactgggccaagaactcagaggacaaggtcactgtctccaagagcatcctgtcttcg
gggctctcagtgtcagacgactcctccgtcttcgtggtggggactgtgctgtatcggaac
gtgggcaacatcctctccctccagaggaacagcactgttctgaactccaaggtcatctcg
gtgactgtgaagccatttcctcgctccctcctcacccctttggaaatcgaattctcccac
ctgtacaacggaaccaccaaccagacctgcatcctgtgggatgaaaatgatggcagagcc
tccgcctccgcctccccgcccggcgcctggtcctggcgcggctgccgaacggtcccgctc
gacgcctcccggaccaagtgtctgtgtgaccggctctccgccttcgccatcttagcccag
ctcagccccgacatgaacatggaaaaggtgctggtcccttctgtcacgttaattgtaggc
tgtggagtatcttcgctgacacttttgctgttgattatcatttatgtctctgtttggaga
actcaggtttttccgtgcctggggtatcattggatgtgctcaagtccttgtcctctcctg
cttttcctcaggctgggcagcactgagcagcgctggtacatccgctccgagcgctccgtc
atcctcatcaacttctgcctctccatcatctcctccaacgccctcatcctgatcggacag
acccagacccggaataaggtgatctgcacgctggtggcggctttcttgcacttcttcttc
ctgtcctctttctgctgggtgctgaccgaggcctggcagtcctacatggccgtgacgggc
cggttacggaaccgcatcatccgcaagcgcttcttgtgcctcggatgggggctccctgcc
ttggtggttgccatttccgtgggatttactaaagccaagggatatggaactgtcaattac
tgctggctgtcgttggagggagggctcctctatgccttcgtgggaccggcggctgctgtc
gttttggtgaacatggttattggcattctggtttttaacaaacttgtatccaaagatgga
ataacagataagaaactgaaggaacgggcaggtcagatggcagtgcccctttacgggatg
acgctcaaatgttccaagtgtggagtagtttcttctgctgaagtttcggccacagccacc
agtaacgccatggcatccctttggagctcctgcgtggtcctgcctctcctggccctcacc
tggatgtctgcagtcctggccatcacagacagacgctcagccctcttccagatcctcttt
gctgtgtttgactccttggagggctttgtcatcgttatggtccattgcatcctgcggcgg
gaggtccaggatgccgtgaagtgccgagttgtggatcgccaggaggagggaaatggagac
tcaggggggtcgtttcagaacggacacgctcagctcatgaccgattttgagaaggatgtg
gacatggcttgtagatcaggtgagcacatcacagtgctgaacaaagacatcaccacctgc
agaacctcaaccatcacgggaaccctgaagcgcccgtcgctgccggacgaggagaaactg
aagctcaaccaccagaaagtgtcgtcgaacttcaacagtcttccagccaacgtctccaag
atgcacctccagggctcgccgcactacctgggggccatcaacctgaacgagttcagcaac
cactccctcaccctgaagaaggacaagaaccagccccccaaatccatctacatctgcgac
ggggacatcttcaagaagctggactcggagctctcgcgggcgcaggagcaaaccctggac
accagctacgtcatcctgcccaccaacacgtccaccctgagggccaagcccaaggacgag
agcaagtacagcatcaacatcgaccagatgcctcagacacggctcatccacctcagcatg
gccaccgacccgggctttgtggtcaagagccccccccgggagcccgtggccatggcgtgc
agcgaggcccaaggctcctccatgatccagcagcagcagcagctggctccacagagcatc
tccaacgagtcacagattcccaacagcctgtgtgacacgggtgactcagggaactcgggc
gtggtgtccaagagcgagaccgtgtccaccctctccatgagctccttggagcggaggaaa
tcccggtatgcagagctagattttgagaaaatcatgcacacgaggaaacgtcaccaagac
atgttccaagacctgaacagaaaactccagcacgcagagaaggacaaggagtctccaaca
acggacagcaagcaagaaaaacagcagacaccaaacaagagaccctgggaaggcatcagg
aaagtccagtccccgccatcatgggttaaaaaggacatggaacccgtggcacagtctccc
ctagaactcaaaactgtagagtgggagaaaacaggggccaccatccctttggtgggacaa
gacattattgaccttcagacagaggtctga

DBGET integrated database retrieval system