KEGG   Empidonax traillii (willow flycatcher): 114065933
Entry
114065933         CDS       T05887                                 

Gene name
MOSMO
Definition
(RefSeq) modulator of smoothened protein
  KO
K23663  modulator of smoothened protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114065933 (MOSMO)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB
Other DBs
NCBI-GeneID: 114065933
NCBI-ProteinID: XP_027756025
LinkDB
Position
Unknown
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASLANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggacaaactgaccatcatctcaggatgcctcttcctggccgccgacatcttcgccatc
gccagcctggcgaacccggactggatcaacaccggcgagtccgcgggtgctctcacagtt
ggccttgtgcgacagtgtcaaaccatccatggacgtgacaggacctgtattcctccacgg
ctgcctcccgagtgggtcactacgttatttttcatcataatgggaatcatttcactaact
gtcacttgtggtttgctggtggcttcccactggcgaagagaagctactaaatatgcccgc
tggatagctttcactggaatgattctattctgtatggcagccctaatatttccaatagga
ttttacatcaatgaagttggaggtcaaccatataaattacccaataacacagtggttggg
tcttcatatgtactgtttgtcttatcaattttctttacaatagtgggacttctatttgct
ggcaaagtttgtttacctggctga

DBGET integrated database retrieval system