KEGG   Empidonax traillii (willow flycatcher): 114066071
Entry
114066071         CDS       T05887                                 

Gene name
GRK3
Definition
(RefSeq) beta-adrenergic receptor kinase 2 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04144  Endocytosis
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114066071 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114066071 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114066071 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114066071 (GRK3)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     114066071 (GRK3)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   114066071 (GRK3)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114066071 (GRK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 114066071
NCBI-ProteinID: XP_027756262
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKITLPEPSIRSVMQKYLEERGELTFDKIFH
QKIGFLLFKDYCMNEIDEAVPQLKFYEEIKEYEKLDSEEERLCRSRQIYDTYIMKELLSC
SHPFSKQAVDHVQTHLAKKQVPASLFQPYIEEICDSLRGKIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDSFSPE
LKSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGIDWQQVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYDAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQRLLRR
APKFLNKSRSTVVELSKPPLSHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgatgtcagctacctgatggcgatggagaagagc
aagagcaccccggcggccagggccagcaagaagatcaccctgcccgagcccagtatccgc
agtgttatgcagaaatacctcgaggaaaggggtgaattaacctttgacaagatctttcat
cagaaaattggatttttgctctttaaagactattgcatgaatgagatcgatgaagctgtc
ccccagctgaagttttatgaagagatcaaggagtacgagaagctggactcagaggaggag
cggctgtgccgcagccggcagatctacgacacctacatcatgaaggagctgctatcctgt
tcccaccctttctcaaaacaagctgtagatcatgtacaaacacatttagccaagaaacaa
gtgccagccagcctttttcagccatatatagaagaaatttgtgatagtctccgaggaaaa
atatttcaaaaatttatggaaagtgacaagtttactagattttgtcaatggaaaaacgta
gagctaaatattcatctgaccatgaatgattttagtgtacatagaataataggaagaggg
ggttttggcgaagtgtacggctgcagaaaagcagacactggaaaaatgtatgcaatgaaa
tgtttagataagaagagaatcaagatgaagcaaggagaaacattagccttaaatgaaaga
attatgctgtctcttgtcagtacaggagactgtccttttatagtgtgtatgacctatgcc
ttccacacccctgacaaactctgcttcattctggacctcatgaatggaggagatttgcac
taccacctctcccagcatggagtgttttctgaaaaagaaatgaggttttatgctactgaa
atcatcctgggcttagaacacatgcacaatcgctttgtggtgtacagagacctgaagcct
gcaaatatcttgttggacgaacacgggcacgtgaggatatcagaccttgggctggcttgt
gatttctccaaaaagaagccacatgccagtgtaggtacccatggatacatggcccccgag
gtgctccagaagggcacagcgtacgacagcagtgccgactggttctccctgggctgcatg
ttgttcaaactgctgagggggcacagtcctttcaggcagcacaaaaccaaagataagcat
gagatcgaccggatgacgctcaccgtgaatgtggagctcccagactcattttctcccgaa
ctgaagtcccttctggaagggctcctgcagcgggatgtgagcaagaggcttggatgccaa
ggaagaagcgcacaagaagtaaaagaacatcctttcttcaaaggcattgattggcagcaa
gtctatttacagaagtaccctccaccactgattcctccccggggagaagtgaatgcagca
gacgctttcgatatcgggtcgtttgatgaagaggacactaaaggcattaagttgcttgat
agtgaccaggagttatataagaacttccctctggtaatatcggagcgttggcagcaagaa
gtagcagaaactgtttatgatgcagtaaatgcagacacagataaaattgaggccagaaaa
agggctaaaaataagcagcttggccacgaggaagattatgccctggggaaggactgtata
atgcatggatacatgctgaaattggggaaccccttcctgactcagtggcagcgtcgttac
ttttacctcttcccaaaccggcttgagtggcgaggagaaggagagtcccggcaaaacctg
ctgacaatggaacaaatagtatctgttgaagaaacacaaattaaagataagaaatgcatc
ttactgagaattaaaggaggaaaacagtttgtcctacagtgtgagagtgaccccgaattt
gttcagtggaaaaaggagctgacggaagctttcactgaggcccagaggttgctgcgccgg
gctccaaagtttctcaataaatctcgctccacagttgtagagctctcgaagccaccgctc
agccacaggaacagcaacgggctgtag

KEGG   Empidonax traillii (willow flycatcher): 114067868
Entry
114067868         CDS       T05887                                 

Gene name
GRK2
Definition
(RefSeq) beta-adrenergic receptor kinase 1 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04144  Endocytosis
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114067868 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114067868 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114067868 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114067868 (GRK2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     114067868 (GRK2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   114067868 (GRK2)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114067868 (GRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like HTH_WhiA Pkinase_fungal
Other DBs
NCBI-GeneID: 114067868
NCBI-ProteinID: XP_027759376
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSRAAPAARASKRIVLPEPSIRSVMQKYLEDRGEVTFDKIFT
QKIGYLLFRDFAFNQAEEAKPLMEFYEEIKKYEKLDSEEERAARSRHIFDHYIMKELLAC
SHPFSKSATEHVQSRLSKKQVPPDLFQPYIEEICQNLRGGIFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEAEMRFYAAE
IILGLEHMHSRFVVYRDLKPANILLDEFGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCMGRGAQEVKEEPFFKGLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLESDQELYRNFPLTISERWQQEVTETVFDAVNADTDKLEARK
KAKNKQLGHEEEYAMGKDCIMHGYMAKLGNPFLTQWQRRYFYLFPNRLEWRGEGESPQSL
LTMEEIDSVEETQVKERKCILLRIRGGKQFVLQCDSDPELVQWRKELRDAQRQAQQLLQR
VPRMQNKPRSPVVELSKVPFIQRSPNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggcggacgtgagctacctgatggccatggagaagagc
cgcgccgcgcccgccgcccgcgccagcaagaggatcgtcctgcccgagcccagcatccgc
agcgtcatgcagaagtacctggaggaccggggagaggtgacctttgacaagatcttcacg
cagaagatcggctacctgctcttccgtgactttgccttcaaccaggccgaggaggccaag
cctctgatggagttttatgaggagatcaagaagtacgagaagctggactcggaggaggaa
cgagccgcccggagccgccacatcttcgaccattacatcatgaaggagctgctggcctgc
tcccaccccttctccaagagcgccacggagcatgtccagagccgcctgagcaagaagcag
gtgcccccagatctcttccagccttacattgaggagatctgccagaacctgcgagggggc
atcttccagaaattcatcgagagtgacaagttcacgcggttctgccagtggaagaacgtg
gagctgaacatccatctcaccatgaacgacttcagcgttcaccgaatcatcggccgcggc
ggtttcggggaggtctacggctgccggaaagcagacacgggcaaaatgtacgccatgaag
tgcttggacaagaagcgcatcaagatgaagcagggcgagacgctggccctcaacgagcgc
atcatgctgtccctcgtcagcaccggggactgcccgttcatcgtgtgcatgtcgtacgcc
ttccacacgcccgacaagctcagcttcatcctcgacctcatgaacgggggggacctgcac
tatcacctgtcccagcacggcgtcttctcggaggcggagatgaggttctacgccgccgag
atcatcctgggcctggagcacatgcacagccgcttcgtcgtgtaccgtgacctcaagcca
gcaaacatcctcctggacgagttcgggcacgtccgcatctccgacctgggcctggcctgc
gacttctccaagaagaagccccacgccagcgtgggcacccacgggtacatggcaccggag
gtgctgcagaagggggtggcgtacgacagcagcgccgactggttctccctgggctgtatg
ctcttcaaactgctccgggggcacagcccgtttcggcagcacaagacaaaggacaagcac
gagatcgaccggatgaccctcaccatggctgtggagctgccggactccttctccccggag
ctgcgctctctgctggaggggctgctgcagcgggatgtcaaccggcgcctgggctgcatg
gggcgtggggctcaggaggtgaaggaggagcccttcttcaagggcctggactggcagatg
gttttcctgcagaagtacccgccgcccctcatcccgccccgcggcgaggtgaacgcggcc
gacgccttcgacatcggctccttcgatgaggaggacaccaagggcatcaagctgctggag
agcgaccaggagctgtaccgcaacttcccactcaccatctcggagcgctggcagcaggag
gtgaccgagaccgtcttcgacgccgtcaacgccgacaccgacaagctggaggcccgcaag
aaagccaagaacaagcagctgggccacgaggaggagtacgccatgggcaaggactgcatc
atgcacgggtacatggccaagctgggcaaccccttcctgacgcagtggcagcgccgctac
ttctacctcttccccaaccgcctcgagtggcgcggggagggcgagtcgccgcagtccctg
ctcaccatggaggagatcgactcggtggaggagacgcaggtgaaggagcgcaagtgcatc
ctgctccgcatccgcgggggcaagcagttcgtgctgcagtgtgatagcgaccccgagctg
gtgcagtggcggaaggagctgcgggacgcgcagcgccaggcgcagcagctgctgcagcgg
gtgccccgcatgcagaacaagccccgctcgcccgtggtggagctcagcaaagtgccgttc
atccagcgctcccccaacgggctctga

DBGET integrated database retrieval system