KEGG   Empidonax traillii (willow flycatcher): 114066109
Entry
114066109         CDS       T05887                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03440  Homologous recombination
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    114066109 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114066109 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114066109 (ATM)
   04210 Apoptosis
    114066109 (ATM)
   04115 p53 signaling pathway
    114066109 (ATM)
   04218 Cellular senescence
    114066109 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114066109 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114066109 (ATM)
   03400 DNA repair and recombination proteins [BR:etl03400]
    114066109 (ATM)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114066109 (ATM)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   114066109 (ATM)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     114066109 (ATM)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    114066109 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT
Other DBs
NCBI-GeneID: 114066109
NCBI-ProteinID: XP_027756327
LinkDB
Position
Unknown
AA seq 3012 aa
MSLALHDLLVCCRRLENEKAVERRKEVENFKRLLCDSETVRQLDRNSDFKQGKQLNWDAV
FSVLQKYFQKEIRNLQQTKPNASASTQTTRQKKIQEVGSLVKYFIRCANKRGPRLKCQEL
LIYVMEIMRDPTSCAAYGSDCSNILLKDILSVRKYWCAISQHQWSELLILYGQLYLKPSG
NISRVLVARVIHTLMRGYCFQTDGLSSDMLIFFSKAMQSARQEKNSAGLDHIVGAMNIFC
NKFADNCRIQICKVGEEILPTLLYIWTHYRPKDSLKESIIELFRLQVHIHHPKGAKTQGR
GAYDLTKWQSILHNLYDLLVNEINLISSRGKYSSGSRNIAVKENLIELMADICHQVFTED
TKVLEITQSFAVTQREPSEDTVPNKRRRIELGWGVIRDNVQMSQKDFDVIPWLQITTQLI
SKYPMSLPSNELPPLLNVLHQLLPQQRRGERTRYVLKCLTEVALCQTQKTDLKSTHKLEL
QRTWAKIWTLTIRSVSFQQIEVESFGLLGAMIQGNIVVTDKELWKIFSGPACKPSSSSVC
CLSLVMSAYSMPENLDTGMEHNISERNLDSALREAIMKWLLSCNLEEEIEECAELPPVLC
SDFPHLVLQKILVSLTMKNCRAAMNFFQNDAKCEQHVQSKEENGFSDVEELYLQTTFDEM
DIFTNFAVNVADKNVTGSRLAINQNLRETLENCLLAMSEKLLSNCAPKSKVLAAEHLVRC
VSLLVGVLGCYCYTGIFKEEDACKSELFQNAKSLIHYAGESISQSKNKLNEDTHVNSLRT
LIMQYTKCLCNCTKNSANKILSTIFLRLLTSKFMNDLIDICKNLMTATGKPSVLGEVDLR
NDPEESIMEVDNQVSDDLFDNRSVTDISDTHESGDMQTATGAVSPLAEEQLTKQDLLLLE
IVRFLCICVTTVQTQTVSFRASDIRRRLLMLTDVSVFDGTKPLHLHMYLVLLKELPTEEH
LLPAMDADMLLKPLPIVCSLYRRDQEVCKEILNNLLPIAVGLAQSDAHAEETGSARGQFL
TVVGAFWHLSQGGKCIASVRVALLNCMKALLEADPHCKWAILNVRNEDLPVNDAFPHFLA
DSHHQVRILAAKSIISLFQDVKQRDSSGMSKPLPLKLQQKAFENAYLRVQEGMRNLVRGD
ASPEELLDKQHNGKAVLLMLITMVLCCSPVCEKQALFALCQSVKENGLEPHLVKKVLKKV
SDIFGYKSIEEFMTSHLDYLVMEWLKINDSGYSLSAFPYVLLNYASLEEFYRSCYKVLVP
HLVVRSQFEDVKSLADKIEKDWRQVLTDCFPKLLVNILPYFAYQSHGMSEVVEQRDTASK
VYDMLKDENCLGKQQIDNLFHNNLPEIVVELLMTLHEPPGTTVEEGTHLSKYVRELDPAP
NPPHFPSSVIKATLDYISNCHKSKLKSIVAVLSKNPDSFQKILLALCKHASDTNNIYKKQ
RVLLIYHLFVSLLLKEIKDGLGGAWAFVLRDVIYTLIHHINSRPVVMRDISMRSFSLCCD
LLHHVCHTAVTCSSDALETHLHVIVGTLIPLAMNQSEIQDQVLGLLKYLVIDNKDNENLY
HAIKCLDPFPEHPAFKDLRATQQKIKYSKGPYSLLEEINHFLSVGVCDSLPLTRLEGLYD
LRKQLEQYKDQMKDLLKNFQEKPEDSVVVKLVVSLLQLSKMAVNHTGEKAVLEAVGSCLG
EIGPMDFSAIALQRAENALDSRAADLFEDRKRQWVFIMLMQINTALTDNCIDVRAAAVSC
LKNILATESGSEFWEVYKNKADPLLVYLQPFRTSRKKFLVVSADDTEARLETLDDTNLWI
PLGESHETWIKHLTSSILDSGGVKNEVLQLMKPLCEVKTDLCQTLLPYLIHDIVLHDSDE
SWRNLLSLHIQKFFTACCKYASSSRSTPNSDSEQETHNFRSLDKVSRRTMLAVVDYLRRQ
KRSASGTVFDDSFWLDLNYLEVAIAAQSCAAHFTALLYAEIYADKINRDKQQERSSFKAA
KSLTFEEESQKTTISTLNEKSKEETGLSLQDLLMDIYRSIGEPDSLYGCGGGRMLQPLAR
LRTYEHEAVWEKALVTYDLETSLSPSTRQAGIIEALQNFGLCHTLSMYLKGLEHENTEWC
TELQEMRYQAAWRNMQWGHISFVRDETERPGYHESLYDALQSLRDKEFSAFHDSLKDARV
NEVKELCKGSLESVYSLYPTLCRLQLIGELENTGLLFSRSVTTQQLNDIYLKWQRHSQLL
KDSDFHFQEPIMALRTVILEILLEKENDNTKRECIKDILTKHLVELSRLARTAKNTQLPE
RAMFQIKQHNPEGCGVSEWQLEEAQVFWAKKEESLALNILKTMIKKLDADWFQVENDPHL
KLMYTECLRLCGTWLAETCLENPTVIMQKYLEKAVEIAASHSGESSDELKKGKMKAFLSL
ARFSDNQYQRIENYMKSSEFENKQALLKKAKEEVGLIRECRVQTNRYTVKVQRELELDEC
AIQALTEDRKRFLCKAVENYISCLLSGEEHDMWIFRLCSLWLENPGVDRVNEMMKKNAQK
IPSYKFLPLMYQLAARMGTKMMGGLGFHEVLNNDRMEAASTIINIVRKKRAHMVRDIGAL
CDAYITLANVDATPWKSQRKQISIPADQPIIKLKDLDVVVPTMEIKVDPTGQYENLVTIR
SFKREFLLAGGMNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQQNTE
TRKRKLNIRRYKVVPLSQRSGVLEWCSGTTPIGEFLVNVEQGAHRRYRPGDYSGYQCQKI
MMDAQKKQPEEKYRIFLQVCENFQPVFRYFCMEKFPDPAVWFEKRLAYTRSVATSSIVGY
ILGLGDRHVQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVE
GVFRRCCEKTMAVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADMSSTL
NTDPQERKRKASSDDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKN
LSQLFPGWKPWV
NT seq 9039 nt   +upstreamnt  +downstreamnt
atgagtcttgcattacatgatctgcttgtttgttgtcgtcgccttgaaaatgagaaagct
gtggagcgaaggaaggaagttgaaaatttcaagagacttctctgtgactctgaaacagtt
cgccagctggaccggaattctgattttaagcaaggaaagcaactcaactgggatgctgta
tttagtgtcttgcagaaatatttccagaaagaaattagaaatctgcagcagacaaaacca
aatgcatctgcttcaacccaaactacgagacagaaaaagatacaagaagttggaagcctg
gtcaaatacttcatcagatgtgctaataaaagaggaccgaggctgaaatgtcaggaactt
ctgatttacgtcatggaaattatgagggatccaacaagttgtgctgcatacggttctgac
tgtagtaacatactcctaaaagatatcctctcagtaaggaaatactggtgtgcgatatcc
cagcaccagtggtcagagttgctgatcctgtatggccagttatacctcaagccttctgga
aatattagtagagtcttggtggctagggtaattcacacacttatgagggggtactgcttc
caaactgacgggttgagttctgatatgcttatcttcttttcaaaagcaatgcaatctgca
agacaggagaagaatagtgcaggcctggatcatattgttggagcaatgaatatcttctgc
aataagtttgctgacaactgtcgcatacagatttgtaaagtaggggaagaaattttgcca
acgttgctttatatatggactcactatagaccaaaggattccctgaaggaatcaataatt
gagttatttcgtctccaagttcatattcatcatccaaagggtgcaaaaactcagggaaga
ggtgcatatgacttaacaaaatggcaaagtatcttgcataacctgtatgatcttctcgtg
aatgaaataaatctcatcagtagtagaggaaagtattcttcaggctctcgtaatattgct
gtaaaggaaaatttaattgagttaatggctgatatttgtcatcaggtttttacagaggat
accaaagtccttgaaattacccagtcatttgctgttacccaaagagagcccagtgaggac
acagtaccaaacaagcgcaggaggattgaactaggctggggggtcattcgagacaacgtg
caaatgtcccagaaggattttgatgtcataccttggttacagattacaactcaattaata
tcaaagtatcccatgagtcttcctagcaatgagctacctcccttgctcaatgtacttcac
cagttactgcctcagcagcgccgaggagagaggacccgatacgtgctgaagtgtctcaca
gaggtagctttgtgccaaacccagaaaactgatttgaaaagcacccacaagttggagctc
cagagaacctgggcaaagatttggactcttaccattcgcagtgtaagcttccagcaaatt
gaagtggagagctttgggctacttggagctatgattcaaggaaacattgtcgtgacagat
aaagaactgtggaagatcttttcaggacctgcatgcaagccttcaagctcttctgtatgt
tgtttatcattagtgatgtctgcctactccatgccagaaaatttggacacaggaatggaa
cataatatttctgaaagaaatcttgattctgcattaagggaggcaataatgaaatggctc
ctgtcctgcaatttggaggaagagatagaagaatgtgcagaattgcctcctgtgctctgc
agtgattttcctcatctcgtattacaaaaaattcttgtgagtcttacaatgaagaactgt
agagctgctatgaacttcttccaaaatgatgctaaatgtgagcaacatgtgcagagtaaa
gaagaaaacggtttttctgatgtcgaagagctgtacctgcagacaacatttgatgaaatg
gatattttcactaactttgcagtaaatgttgcagataaaaacgtgactggttcaagactt
gccatcaaccaaaatcttagggaaacactggagaattgccttttagcaatgtcagaaaag
cttttaagcaattgtgctcctaagtctaaggttcttgctgctgaacaccttgtccgatgt
gtcagtctcttggttggtgttcttggttgctattgctacactggtatatttaaagaagag
gatgcctgtaaatcagagttgttccagaatgctaagtctctcattcactatgctggagaa
agcatttctcagtcaaaaaacaaactaaatgaagatacccatgtcaactctctgaggact
ttgataatgcagtatacaaaatgtttgtgcaattgcaccaagaacagtgctaataagata
ttgtctactatattcctgcgtttgttaacatcaaaatttatgaacgatctcatagatatt
tgcaaaaatctcatgacagctactggaaaaccaagcgtactgggagaagtggatctcagg
aatgatcctgaggagagtataatggaagtagataaccaggtatctgatgatctgtttgat
aatcgttcagtgactgacatcagtgatacacatgaatctggtgatatgcaaactgcaaca
ggtgctgtgagcccattagctgaggaacagttgacaaagcaggatttacttctccttgaa
attgtgaggttcttatgtatttgtgtaactacagtccaaactcagacagtgagcttccga
gcctctgacatccggcggaggctgttaatgcttactgatgtcagtgtctttgatggcact
aaaccattacatctgcacatgtacttggttcttttgaaggagctccctactgaagaacac
ctcttgcctgcaatggatgcagatatgcttctgaaacctcttcctattgtatgttctttg
taccgtcgagatcaagaagtctgtaaagaaattctgaataatttgctccctatagcagta
gggttggcccagtctgatgcgcatgctgaagagacagggagtgccagaggacagtttttg
acagttgttggagccttttggcatttatctcaaggagggaagtgcattgcatcagtaaga
gtggcccttttaaactgcatgaaagctctgcttgaggctgatcctcattgcaagtgggca
atcctcaatgtgagaaatgaagatctacctgtgaatgatgccttcccacatttccttgca
gacagtcaccatcaagttcgcattcttgctgcaaagtcaattatcagtttgtttcaagat
gtgaaacagagagattcttctggaatgtcaaaacctcttcccttgaagctccagcagaag
gcttttgagaatgcatatctcagagttcaggaaggaatgagaaacctggtcaggggtgac
gcgagtcctgaagagcttttggacaaacagcataatggaaaagcggttttgctgatgctt
ataaccatggtcctgtgctgcagtccagtctgtgaaaagcaagctttgtttgccctttgc
cagtctgtgaaagagaatggattagaacctcacctggtgaaaaaggttttgaagaaagta
tctgacatttttggctataaaagtatagaagaattcatgacatcacatttagactatttg
gtgatggagtggctgaaaataaatgacagtggatacagcctatctgcatttccttatgtt
cttctgaactatgctagccttgaagaattctacaggtcttgttataaagttctggttcca
caccttgtggttagaagtcaatttgaagatgtgaagtcacttgctgacaagattgaaaaa
gactggagacaggttctcacagactgttttccaaagttacttgtgaatatccttccgtat
tttgcctatcaaagccatggaatgagtgaagtagtggagcaaagagatacagcttctaaa
gtctacgacatgcttaaggatgaaaactgcttaggaaaacagcaaatagacaatttgttt
cataataacttaccagagattgtggttgaactgttgatgactttacatgaaccacctggt
accacggtagaagaaggaactcatctaagtaaatacgtaagagaactggatcctgctccc
aatcctcctcattttccatcctctgtgattaaggcaaccttggactatattagcaactgt
cataaaagcaaattaaaaagtattgtagcagttctttctaaaaaccctgattcattccag
aaaatccttctagccctttgtaagcatgcatcagatacaaacaacatttataagaaacag
agagttcttctaatttatcacttgtttgttagtctcttacttaaagaaataaaagatggt
ttaggcggagcctgggcttttgtactccgagatgtaatttacaccctgattcaccacatc
aatagcagacctgttgttatgagagacatatccatgcgcagcttttcactctgttgtgat
ctccttcatcacgtttgccacacagcggttacgtgcagcagtgatgctctagaaacacac
cttcatgttattgtaggaaccctaatacctcttgccatgaaccagtctgagattcaggac
caggtcctaggcttgttgaagtatctggtgatagataataaggataatgaaaatctttat
cacgcaatcaaatgcttagatccttttcctgaacatccagcttttaaagatttgcgagca
actcagcagaaaataaaatacagtaaaggaccatattctcttttggaggaaattaatcac
tttctctcagttggtgtttgtgattcactgcccttaacacggcttgaaggactgtatgat
ttacgcaaacaactggaacaatacaaagatcagatgaaggatctcctgaaaaatttccag
gaaaaaccagaagattctgtagtagtgaaattggtagtgagcttactgcagctgtccaag
atggcagttaaccatacaggagaaaaagcagtgctggaggctgttggaagttgcttggga
gaaataggtcccatggatttctccgccatagctcttcagcgtgctgaaaatgcattggat
tctagagcagcagacttatttgaagatagaaaacgtcagtgggtcttcataatgttaatg
caaataaatactgcgttaacagataattgtattgatgttagagctgctgctgtttcctgt
ttgaaaaacatattagccacagagtctggcagtgaattttgggaagtttataaaaataaa
gctgatccgctgttagtctatctacagcctttcagaacatctagaaaaaagtttcttgta
gtatctgctgatgatacagaggctcgtttagaaactttggatgacacaaacctgtggatt
cctctgggagaaagtcatgagacctggatcaagcacctaactagttcaatattggacagt
ggaggtgtgaaaaatgaagttttacagttaatgaagccactgtgtgaggtgaaaacagac
ttgtgtcaaactttgcttccatacttgattcacgatatagttcttcatgactcagatgaa
tcttggagaaatcttctgtcacttcatatccagaagttttttacagcctgttgcaaatat
gcctcgtctagtagatctactccaaattcggattcagagcaagaaacccataattttaga
agtttggataaagtatctcgacgaaccatgcttgctgttgttgattacttaagaagacaa
aagagatctgcttcaggtacagtttttgatgacagcttctggctggatctgaattatctt
gaggttgctatagcagcacagtcttgtgctgctcacttcacagccttgctctacgcagaa
atctacgcagacaagataaatagagacaaacagcaagaaagatcttcttttaaagcagcc
aagagtttgacatttgaagaagaaagtcaaaaaacaactattagtactttgaatgaaaaa
agtaaagaagaaactggcttaagtttacaggaccttctcatggacatatacagaagcatt
ggagaacctgacagtctctatggctgtggtggaggaagaatgttacagccattagcacgg
ctaagaacatatgagcatgaagcagtatgggagaaagcccttgtaacatatgaccttgag
acaagcctctctccatctactcgccaggcaggaataatagaggctttgcagaattttggt
ctttgccacactctctccatgtatttgaaagggctggaacatgaaaacactgagtggtgc
acggaactgcaggaaatgcgctaccaggcagcatggaggaatatgcaatggggccacatc
tcttttgtcagagatgaaacagaaagaccaggttaccatgaatcactgtatgatgctctt
cagtctttacgagataaggaattctctgcttttcatgacagtcttaaagatgccagggtg
aatgaagtcaaagaactgtgcaaaggcagtcttgaatctgtttattcattatacccaacc
ctttgtagactacagctgattggagagttggaaaacacaggtctgctgttctccagatct
gttactactcaacaactgaatgacatttatttgaaatggcagagacactcccaacttctc
aaggacagtgacttccatttccaggaacccatcatggctctgcgcactgtaattttggaa
atcttgcttgagaaggagaatgacaataccaaaagagaatgtattaaagacatcctgacc
aaacatctggtggagctctctagattggcaagaactgctaaaaatacacagcttccagaa
agagctatgtttcagatcaaacaacacaatccagagggatgtggcgtttctgaatggcaa
ctagaagaagctcaggttttctgggctaaaaaagaagagagtcttgcactgaatatactt
aaaacgatgataaaaaaattagatgcagattggtttcaggttgagaatgatcctcacctg
aaactgatgtatacagagtgtctgaggctgtgtggaacctggttagcagaaacgtgcttg
gaaaaccctacagtcatcatgcagaaatacttagaaaaggctgtggaaattgctgcaagc
cacagtggagagagcagtgatgagctgaagaaaggaaagatgaaggccttcctgtctttg
gctcgtttctctgataatcagtaccagcgaattgagaattacatgaaatcctcagagttt
gaaaataagcaggcactactgaagaaggccaaggaggaggtcggcctcatcagggagtgt
agagttcaaaccaatagatacacagtgaaggttcagcgagaacttgaactggatgaatgt
gccatacaagccctgactgaggatcgtaaacgtttcctgtgtaaagcagtggagaactat
atcagctgtttactaagtggagaagaacatgatatgtggatattccgactctgttctctg
tggcttgaaaatcctggagttgacagagtcaatgaaatgatgaagaaaaatgcacagaag
attccctcatacaagtttttgcctctgatgtaccagctggctgctcggatgggaactaag
atgatgggtggtttaggatttcacgaagttctgaataatgacagaatggaggctgctagc
actataatcaatatcgtaagaaaaaagagagctcatatggttagagacatcggagcactt
tgtgatgcttacatcacattagcaaatgtagatgctactccgtggaaatctcaaagaaaa
caaataagtattccagctgaccagccaattattaaactgaaggacctggatgttgttgtt
cctaccatggaaattaaggtggatcccacaggacaatatgaaaatttggtcacaataaga
tctttcaagcgagaatttcttttagcaggaggcatgaatctgcctaaaataatagattgt
gtaggatcagatggtaaagaaaggaggcagctggttaaggggcgtgatgacctcagacaa
gatgctgtcatgcaacaagttttccagatgtgcaatacattgctccagcaaaacactgaa
acacgaaagagaaaattaaatatccgaagatacaaggtggttcccctttcccagagaagt
ggtgttctcgagtggtgttcaggaacaactcccattggggagtttctagtcaatgtcgaa
caaggagctcacaggaggtacaggccaggagattactctggttatcaatgtcaaaaaata
atgatggatgcacaaaagaaacaacctgaagagaaatacagaatcttcttgcaagtctgt
gagaattttcaacctgtgtttcgatatttctgcatggaaaaattcccggatccagctgtg
tggtttgaaaaacgattggcatacactcgtagtgtggctacatcttctatagttggctac
attcttggacttggagacagacatgttcagaatatcttgatagatgaacaaacggcagaa
ctagtgcatatagatctgggggttgcctttgagcaaggtaaaatccttcccacaccagag
actgttccatttagattgaccagggacattgtggatggaatgggaattactggcgtggaa
ggagtcttcagaagatgctgtgagaaaacaatggctgttatgagaaattctcaagaagct
ttgctgactattgtagaggtgctgctctatgatcctcttttcgactggaccatgaacccc
ctgaaagctttgtacctgcagcagagaccagaggatgaggctgacatgagctctacactc
aatactgatccacaggaacgtaaaagaaaagccagcagtgacgaccagagctttaacaaa
gtggcggagcgtgttctgatgagactccaggagaagctgaaaggtgttgaggagggaaca
gtgctcagtgtaggagggcaagtgaacctcctcatacagcaggccatggaccctaaaaat
ctgagccaactctttcccggatggaaaccctgggtgtga

DBGET integrated database retrieval system