KEGG   Empidonax traillii (willow flycatcher): 114066291Help
Entry
114066291         CDS       T05887                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00010  Glycolysis / Gluconeogenesis
etl00051  Fructose and mannose metabolism
etl00052  Galactose metabolism
etl00500  Starch and sucrose metabolism
etl00520  Amino sugar and nucleotide sugar metabolism
etl00524  Neomycin, kanamycin and gentamicin biosynthesis
etl01100  Metabolic pathways
etl01200  Carbon metabolism
etl04910  Insulin signaling pathway
Module
etl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114066291
   00051 Fructose and mannose metabolism
    114066291
   00052 Galactose metabolism
    114066291
   00500 Starch and sucrose metabolism
    114066291
   00520 Amino sugar and nucleotide sugar metabolism
    114066291
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    114066291
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114066291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114066291
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     114066291
Membrane trafficking [BR:etl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114066291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 114066291
NCBI-ProteinID: XP_027756659
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPVEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgataaatacctctacgccatgcggctctccgacgaaacgctgctggacgtcatg
gctcgcttcaggagggagatgaagaacggcctctccagggattttaaccccacagctgca
gtcaagatgcttcccacgtttgtcaggtccattcctgacggttcagagaaaggagatttc
attgcactggacctcggcggttcttatttccggatcctgcgggtgaaggtgtcgcatgaa
aagaagcagacggtgcagatggaaagcgaaatttataacacccctgaggatatcatgcac
ggcagtgggacacggctttttgatcatgttgctgagtgcctgggagacttcatggagaaa
caacaaatcaaagacaagaaattgccagtcgggtttacgttttctttcccctgtcgacag
tccaagctagatgagggtattctgataacctggacgaagcgcttcaaagcaagtggagtg
gagggagcagatgtcgtgaggctgcttaacaaggccatcaagaaacgtggggactacgac
gcggatatcatggctgtcgtgaacgacaccgtcgggacgatgatgacctgtggctttgac
gaccagcgctgcgaagttggcctgatcattggcaccggcaccaacgcatgttacatggag
gagatgcggcacatcgacctggtggaaggggacgagggcaggatgtgcatcaacaccgag
tggggggcctttggggatgacggctcactagaagacatcaggactgagtttgatcgcgag
attgaccgtggatcccttaacccagggaagcagctgtttgagaagatggtcagcgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgcttttc
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccatagaaaagagcaaagaaggtttgaacaaagccaaagagatcctgacgcggctgggg
gtggagccgtcccacgaggactgcatcgccgtccagcacgtctgcaccatcgtgtccttc
cgctccgccaacctggtggcctccaccctgggcgccatcctcaaccagctgcgggacaac
aagggggtgggccgcctccgcaccaccgtgggggtcgatggctccctctacaagatgcac
ccacagtacgcccggcgcctgcacaaaaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtccgagagcggcagcggcaagggggcggccatggtgacggccgtggcc
taccggctgtcggagcagcaccggctcatcgacgagaccctggccgagttcaagctcacc
catgagcagctgctgcaggtcaagaagaggatgagggcggagatggaagcggggctgaag
aaaaagactcacgagactgccaaagtgaagatgctgcccaccttcgtccgcagcacgccg
gatgggacagaaaacggagactttctggcacttgaccttggagggacaaactttagagtt
ttgttggtgaaaatccgcagtggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcctgtagaggtgatgcagggaacaggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattatatggggataaaaggtgcacgtcttcctcttggcttc
accttttccttcccttgcaagcagaccagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgcgagggagaagatgtggtatatttgcttagagaagga
attaaaagaagagaggaatttgacttggatgtggtggctgtggtgaatgatacggtgggc
acgatgatgacctgtgcttatgaagacccaaactgtgaaatcgggctcattgtgggaacg
ggcagcaatgcctgttacatggaagagatgaggaacatagagatggtggatggtgagcag
gggcggatgtgcgtgaacacggagtggggagcgttcggggataacggatgcctggacgac
atcaggacaatatatgacaaagcagttgatgactattcactgaatgctggaaagcaaagg
tacgagaagatgatcagtgggatgtacctgggggaaatcgtccgcaacattttgatcgac
ttcaccaaacgggggttcctgttccgaggccagatttcagagacactgaagaccaggcat
atcttcgaaaccaagttcctgtctcagattgagagtgacaggctggccttgctgcaggtg
agaaccatcctgcagcagctggggctcaacagcacctgcgacgacagcatcatcgtcaag
accgtctgcggggcggtgtcgaggcgagcagctcagctgtgtggcgctggaatggctgcc
attgtagataaaattagggagaacagagggttggagcgcctggagataacggtcggtgtg
gatggcactctgtacaaactacatcctcacttttcgaggatcatgcaccaaacagtcaaa
gacctggcacccaactgcgacgtgaccttcctgctgtcggaggacggcagcgggaagggg
gccgcgctcatcacggccgtgggatgccggctgcgcgaggctgagcagaactga

DBGET integrated database retrieval system