KEGG   Empidonax traillii (willow flycatcher): 114066430
Entry
114066430         CDS       T05887                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114066430 (TGFA)
   04012 ErbB signaling pathway
    114066430 (TGFA)
SSDB
Motif
Pfam: Adeno_E3_CR2 DUF1180 TMEM154 Insulin_TMD
Other DBs
NCBI-GeneID: 114066430
NCBI-ProteinID: XP_027756912
LinkDB
Position
Unknown
AA seq 125 aa
MAGGPAALALGVLLAACHALENTTAARNVCCPRSRCRCHSGYVGTRCEHADLLAVVAANQ
KKQTITALLVVAVVASVLLISVCVLIHCCRLRKRCPWCREPGGGQEKPGGLLKGGTSCCH
AETGV
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcgggcggcccggccgcgctggccctcggtgtcctgctcgccgcatgccacgcgctg
gagaacaccacggcagcccggaatgtctgctgtccccgttcccggtgcaggtgccactct
gggtacgtggggacacgctgtgaacacgccgacctcctggctgtggtggctgccaaccag
aaaaaacagacgatcacagccctgctcgtggtggccgtggtggcctcggtgctgcttatc
tctgtctgtgtcctcatccactgctgccgcctgcggaagcgatgcccctggtgccgggag
cccggagggggccaggagaaaccaggggggctcctcaaggggggcacctcctgctgccac
gctgagacaggtgtgtga

DBGET integrated database retrieval system