KEGG   Empidonax traillii (willow flycatcher): 114066600
Entry
114066600         CDS       T05887                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl05132  Salmonella infection
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114066600
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114066600
   04217 Necroptosis
    114066600
   04115 p53 signaling pathway
    114066600
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114066600
  09172 Infectious disease: viral
   05164 Influenza A
    114066600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:etl04050]
    114066600
   04090 CD molecules [BR:etl04090]
    114066600
Cytokine receptors [BR:etl04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114066600
CD molecules [BR:etl04090]
 Proteins
  114066600
SSDB
Motif
Pfam: TNFR_c6 Death DUF3377
Other DBs
NCBI-GeneID: 114066600
NCBI-ProteinID: XP_027757205
LinkDB
Position
Unknown
AA seq 420 aa
MAAGGAAGLLLVMLLTMPGTQAKNCEEGEYFHEGHCCVSCPAGTFAAQHCSAPHSRGKCH
PCKEGESYTAHENGLDECLSCKQCKDDQVTVKPCTLTHNTECQCKQGYFCTDKSCEICQR
HSKMYPEGKEIDQNCNATTGLGCDLPDQGSTTVFWVILPMFLAVAVIVLLFLVFKKLKCG
KAPSTDRDVEKSLKSEGSSESLILPKRETPAPANNSMNPEGESCGESPESQAQTNINLEA
EDASPEEDSALTEQDTSLHGDWKHRVLRRLRRIAESSFQSKPGQNFASHQNNLSNVPSNG
TPANRVVRKPKRRIIVKDLSQKERRVCFEAFIKEVPPKNWRQLMRTHLHDNDIDKIIYNF
NNDIEEQSYQMLLIWRNTLGEKQCIIKLLSELKHIDRKAYDNVVNTLKSNNIISKVEATD
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcagccggaggagcggcggggctgctgctggttatgctgctgacaatgcctggaacc
caagcaaagaactgtgaggagggagagtacttccatgaaggacactgctgtgtatcttgt
ccagcaggtacttttgctgctcagcactgcagtgctccacattcgagaggaaaatgtcac
ccttgcaaggaaggagagagttataccgcacatgagaacggcttggacgaatgcttgtct
tgcaaacagtgcaaagatgatcaagtaactgtgaaaccctgtactctgacgcataatact
gaatgccagtgcaaacaagggtatttctgcactgacaagagctgtgaaatatgtcagaga
cacagtaaaatgtacccggaagggaaagaaatcgaccagaattgcaatgctactacaggc
ctaggatgtgacttaccggatcaaggaagcacaactgttttttgggttattcttccaatg
tttttggctgttgctgttattgttttgctcttcttggtatttaaaaagttgaagtgtggt
aaagctccttcaactgatagagatgtggagaaaagtctgaagtctgagggcagtagtgaa
agcctcattttgccaaaaagggagacacctgcacctgcaaataactcaatgaacccagag
ggtgaaagctgtggtgagagcccagagagccaagcacaaaccaatattaacctggaagca
gaagatgcatcaccagaggaagatagtgcacttactgagcaggacaccagcctgcatggg
gactggaagcaccgtgtgctaaggaggttgaggaggattgctgagtcttcatttcaatca
aaacctggccagaattttgcttctcatcagaataacctatctaatgtaccaagtaatgga
acaccagcgaatcgtgtggtacgaaaaccaaagcgtcgaataattgttaaagatctctct
caaaaagaacggagagtttgctttgaggcctttataaaggaagtaccaccaaaaaactgg
aggcagcttatgagaactcatctccatgataatgatattgataaaattatttataacttt
aataatgatatagaagagcaatcctatcagatgcttctcatctggagaaacacactggga
gaaaaacagtgtattattaagttactgagtgagttgaagcatatagataggaaggcttat
gataatgtagtgaacactttaaaaagtaataatattataagtaaagtagaagctacagat
taa

KEGG   Empidonax traillii (willow flycatcher): 114069860
Entry
114069860         CDS       T05887                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl05132  Salmonella infection
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114069860
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114069860
   04217 Necroptosis
    114069860
   04115 p53 signaling pathway
    114069860
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114069860
  09172 Infectious disease: viral
   05164 Influenza A
    114069860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:etl04050]
    114069860
   04090 CD molecules [BR:etl04090]
    114069860
Cytokine receptors [BR:etl04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114069860
CD molecules [BR:etl04090]
 Proteins
  114069860
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 114069860
NCBI-ProteinID: XP_027762755
LinkDB
Position
Unknown
AA seq 462 aa
MIQARRPSWPPSWQITPLSAQTPPPCPVCSELPFPPAGTHLADFCTEPNGSSECSPCKRE
EFMEYPNVFHSCYECRKCREDQVELSPCQATRNTECACKEGTFCDPDLPCEMCEKCQPRC
PEGQMVLSPCTPYRDLQCGPAKGTDLFYVWIIIGVVILVIIVLLICKYLSCCPEGPGHGR
ADGCSWNPDTIRASLLPQNYLTQKLRWYRRVNVGTQDNDLNEQRSRDQPLPVESPSCKTC
SLQSTARALCGFKAAAEQTALLSLARTPRGSSPCSWPAASPEPGNRDVLGVEGGVLPQEP
LERGRGSPVPALGGLGDSFCARAWWVLQTLPLQVMLQRAPCPRERPRRDLVPQTGKEPIP
ALRGTFYIFAGINYSYWKKFGRSLDVQENDLPLDRAQDSFYEMLNKWLEREGSKASVNTL
LETLDQLGLSGIADDISSELLRRGLFKPAGAEEQGGSCASVP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgatacaggccaggcgcccttcttggccacccagctggcaaatcacccccctctctgct
cagacacctcctccctgccctgtgtgctcagagctgccctttccccccgcaggcacccac
cttgcagatttctgcacagaaccgaacggctccagcgagtgttcgccctgcaagagggag
gagttcatggagtaccccaacgtcttccactcctgctatgagtgtcggaagtgcagggaa
gatcaggtggagctgagtccctgccaggccaccaggaacacggagtgtgcctgcaaggag
ggcaccttctgcgacccggacctgccctgcgagatgtgcgagaagtgccagccccggtgt
cccgaggggcagatggtgctgtctccctgcactccttacagggatctgcagtgtggtcct
gccaagggcaccgacctcttctacgtctggattatcatcggggtggtgatcctggtgatt
attgtgcttctcatctgtaagtacctctcctgttgcccagagggaccaggccatggcagg
gcagatggctgcagctggaatcctgacaccatccgtgcttctctcctgccacagaactac
ctgacgcaaaagctgagatggtacaggagggtgaacgtggggacacaggacaacgacctc
aacgagcagcgctcgcgggaccagccgctccccgtggagtccccgagctgcaaaacctgc
tcgctgcagtcaactgccagagccctctgtgggtttaaggctgctgctgagcaaacagct
ctcctctccctggccaggaccccacgaggcagctctccctgctcgtggcctgctgccagc
ccagagccaggaaaccgggatgtcctgggggtggaggggggtgtcctgccccaagaaccc
ctggagagagggagagggtctccagtccctgcactgggggggcttggggatagcttttgt
gccagggcttggtgggtgctacagacactgccattgcaggtgatgctgcagagagccccc
tgtcccagggagagacccaggagggatctggttccacagacagggaaagagcccattccg
gcgctgagaggcactttctacatctttgctggaatcaactacagctactggaagaaattc
ggccggagcctcgatgtgcaggagaacgatctgcccttagaccgggcccaggactccttc
tatgaaatgctcaacaagtggctggagagggaggggtccaaggcctctgtgaacacgctg
ctggagaccctggaccagctcggtctcagtgggattgcagacgacatctcctctgaactg
ctcaggaggggattatttaaacccgcaggagccgaagagcaaggcgggtcctgcgcctcc
gttccttga

DBGET integrated database retrieval system