KEGG   Empidonax traillii (willow flycatcher): 114066726
Entry
114066726         CDS       T05887                                 

Gene name
SIVA1
Definition
(RefSeq) apoptosis regulatory protein Siva
  KO
K22744  apoptosis regulatory protein Siva
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114066726 (SIVA1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 114066726
NCBI-ProteinID: XP_027757449
LinkDB
Position
Unknown
AA seq 170 aa
MPKRSCPFGEAAPLQLKTRVGLRELSRGVRGEEYRREVFERTRRLLFRGAQAYMEGAGPA
AARPAEPQPPGDAQGGGPRWNGQLLIGHDGKLLRRPAERVPPVGASRACSSCVRTTDVKE
VCTQCDRFVCQSCSRLCSCCNRVTCSLCSTIDYADVGEQVLCNGCSIFQV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgccgaaacgctcctgccccttcggggaggcggctccgctccagctgaagacccgcgtg
gggctgcgggagctgagccgcggcgtgcggggcgaggagtaccggcgggaggtgttcgag
aggacccggcggctgctcttcaggggggcccaggcgtacatggaaggagccggtcccgcc
gctgcccgcccggcggagccgcagccgcccggggatgcgcagggaggggggccccgctgg
aacgggcagctcctcatcggccacgacgggaaactgctgcggcggcccgcggagagggtt
ccacctgtgggagcctccagagcctgctcgtcgtgcgtaagaaccactgatgtgaaggag
gtgtgcacgcagtgtgaccggtttgtctgccagagctgcagcaggctctgcagctgctgt
aacagggttacctgctctttgtgctccactattgattatgctgatgtgggagagcaagtt
ctctgcaatggttgttcaatatttcaagtctga

DBGET integrated database retrieval system