KEGG   Empidonax traillii (willow flycatcher): 114067087
Entry
114067087         CDS       T05887                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114067087 (CCND2)
   04340 Hedgehog signaling pathway
    114067087 (CCND2)
   04068 FoxO signaling pathway
    114067087 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114067087 (CCND2)
   04115 p53 signaling pathway
    114067087 (CCND2)
   04218 Cellular senescence
    114067087 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114067087 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 114067087
NCBI-ProteinID: XP_027758079
LinkDB
Position
Unknown
AA seq 285 aa
MELLCCEVDPMRRALPDPNLLYDDRVLHNLLTIEERYLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKVPLPKDKLLLIRKH
AQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDDGDSLTDLLAKITNTDVDCLKAC
QEQIEAVLVNSLQQVQQQQQQSNPSKTVDELDQASTPTDVRDINL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggatcccatgaggagagctctgcccgacccgaacttg
ctctacgatgaccgcgttttgcacaacttactaaccatagaggagaggtatctgccccag
tgctcctacttcaagtgcgtccagaaggacatccagcccttcatgaggaggatggtggcc
acttggatgctggaggtctgcgaagagcagaagtgcgaagaagaagttttccctctggcc
atgaattacttggacagattcttagctgtggtgcccactcggaagtgccatctgcagctg
ctgggggcagtgtgcatgttcctggcctccaagctgaaagagacaatccccctcacagcc
gagaagctgtgcatatacacggacaattccatcaaaccccaagagctgctggaatgggag
ctggtggtgctggggaagttgaagtggaaccttgcagccgtcaccccccacgatttcatc
gagcacatcctacggaaggtgcctctccctaaagacaagttgcttttgatccggaagcat
gcacagaccttcatcgccctttgtgccacagattttaactttgccatgtacccaccgtca
atgatagcaactggaagtgtgggagcagccatctgtggccttcagctcgatgatggggac
agcctcacggacctcctggccaagatcaccaacacagatgtggactgccttaaagcttgt
caggaacagatcgaggcggtgctcgtgaacagccttcagcaagtccagcagcagcagcag
caaagcaatccttccaagacggtggatgaactggaccaggccagcactcccacagatgtg
agggatatcaacctgtga

KEGG   Empidonax traillii (willow flycatcher): 114067504
Entry
114067504         CDS       T05887                                 

Definition
(RefSeq) G1/S-specific cyclin-D3-like isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04510  Focal adhesion
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114067504
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114067504
   04115 p53 signaling pathway
    114067504
   04218 Cellular senescence
    114067504
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114067504
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114067504
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 114067504
NCBI-ProteinID: XP_027758817
LinkDB
Position
Unknown
AA seq 291 aa
MELLCVESASRVPRAGPDPQLLGDRRVLRNLLSLEERYSPRVSYFQCVQRDIQPYMRRML
AVWMLEVCEEQKCEEEVFPLAMNYVDRFLSSVPVQKNHLQLLGAVCMLLASKLRETMPLT
VEKLCIYTDNSITPQQLLHWELLVLEKLKWDLVSVIANDFLPHILHRLPLPVDNVELVKK
HAQTFIALCATDCTFVMYPPSMIATGSIGAAIHGLTISVSGFGGEAMTELLAGITGTDVD
CLKACQEQIEAALAESLKQASQSQQDFSAKAAAYGGSQPTSTPTDVTDVNL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagctgctgtgcgtggagtcggcgtcccgcgtgccccgcgcggggcccgacccgcag
ctcctgggggaccggcgggtgctgcggaacctgctgagcctggaggagcgctacagcccc
cgcgtgtcctacttccagtgcgtgcagcgggacatccagccctacatgcggaggatgttg
gccgtctggatgctggaggtgtgtgaggagcagaagtgtgaggaagaggttttccccctg
gccatgaattacgtggatcggttcctgtcgtcggtgcccgtgcagaagaaccacctgcag
ctcctgggggctgtgtgcatgctgctggcctccaaactgagagaaaccatgcccctgacc
gtggagaaactctgcatttacacagacaactccatcacacctcagcagctcctgcactgg
gagcttctggtcctggagaagctaaagtgggacctggtctcagtgatagccaacgatttc
ctgccccacatcctccaccgcctcccgctgcccgtggacaacgtggagctggtgaagaaa
cacgcccagacattcatcgccctgtgtgccacagactgcacgtttgtgatgtaccccccg
tccatgatcgccacgggcagcattggagccgccatccacgggctgaccatctccgtgagc
ggcttcggcggcgaggccatgacggagctgctggccgggatcacaggcactgacgtggac
tgcctgaaggcctgtcaggagcagatcgaggcagctctagccgagagcctgaagcaggcg
tcgcagtcacagcaggatttcagcgccaaggcggcggcgtacgggggcagccagcccacc
agcacccccacggacgtcaccgacgtcaacctgtga

KEGG   Empidonax traillii (willow flycatcher): 114067926
Entry
114067926         CDS       T05887                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04371  Apelin signaling pathway
etl04510  Focal adhesion
etl04530  Tight junction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114067926 (CCND1)
   04340 Hedgehog signaling pathway
    114067926 (CCND1)
   04371 Apelin signaling pathway
    114067926 (CCND1)
   04068 FoxO signaling pathway
    114067926 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114067926 (CCND1)
   04115 p53 signaling pathway
    114067926 (CCND1)
   04218 Cellular senescence
    114067926 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114067926 (CCND1)
   04530 Tight junction
    114067926 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114067926
NCBI-ProteinID: XP_027759498
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcaaaagtgcgaagaggaagttttccccttg
gctatgaattacttggacagatttttgtcttttgaacccctcaagaaaagccggttgcaa
ctgctcggagctacctgcatgtttgtggcttcaaaaatgaaggagactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggccgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgggcctgccaagaacagattgaatccctcctggaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

KEGG   Empidonax traillii (willow flycatcher): 114071008
Entry
114071008         CDS       T05887                                 

Definition
(RefSeq) G1/S-specific cyclin-D3-like
  KO
K10152  G1/S-specific cyclin-D3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04510  Focal adhesion
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114071008
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114071008
   04115 p53 signaling pathway
    114071008
   04218 Cellular senescence
    114071008
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114071008
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114071008
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 114071008
NCBI-ProteinID: XP_027764464
LinkDB
Position
Unknown
AA seq 201 aa
MELLCVESASRVPRAGPDPQLLGDRRVLRNLLSLEERYSPRVSYFQCVQRDIQPYMRRML
AVWMLEVCEEQKCEEEVFPLAMNYVDRFLSSVPVQKNHLQLLGAVCMLLASKLRETMPLT
VEKLCIYTDNSITPQQLLVTTLYLLPSSADCLKACQEQIEAALAESLKQASQSQQDFSAK
AAAYGGSQPTSTPTDVTDVNL
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagctgctgtgcgtggagtcggcgtcccgcgtgccccgcgcggggcccgacccgcag
ctcctgggggaccggcgggtgctgcggaacctgctgagcctggaggagcgctacagcccc
cgcgtgtcctacttccagtgcgtgcagcgggacatccagccctacatgcggaggatgttg
gccgtctggatgctggaggtgtgtgaggagcagaagtgtgaggaagaggttttccccctg
gccatgaattacgtggatcggttcctgtcgtcggtgcccgtgcagaagaaccacctgcag
ctcctgggggctgtgtgcatgctgctggcctccaaactgagagaaaccatgcccctgacc
gtggagaaactctgcatttacacagacaactccatcacacctcagcagctcctggtaacc
accctctacctcctccccagctctgctgactgcctgaaggcctgtcaggagcagatcgag
gcagctctagccgagagcctaaagcaggcgtcgcagtcacagcaggatttcagcgccaag
gcggcggcgtacgggggcagccagcccaccagcacccccacagacgtcactgacgtcaac
ctgtga

DBGET integrated database retrieval system