KEGG   Empidonax traillii (willow flycatcher): 114067411
Entry
114067411         CDS       T05887                                 

Gene name
SIAH1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1 isoform X1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04120  Ubiquitin mediated proteolysis
etl04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114067411 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114067411 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114067411 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114067411 (SIAH1)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114067411 (SIAH1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    114067411 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 114067411
NCBI-ProteinID: XP_027758622
LinkDB
Position
Unknown
AA seq 313 aa
MTGRAASSGPCSWKGVWSACLPGTKACKGKDMSRQTATALPTGTSKCTPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacgggcagagccgcctccagcgggccgtgttcctggaagggcgtctggtctgcgtgt
ctgccggggactaaagcctgcaaggggaaagacatgagccgtcagactgccacagcactc
cccacgggtacctccaagtgcacgccatcacagagggtgcccgcgctgacgggcaccaca
gcctccaacaatgacttggccagtctctttgagtgtcctgtgtgctttgactatgtgctg
ccacccatcctacagtgtcagagtggtcacctggtttgtagcaactgtcgccccaaactt
acgtgctgtccaacctgccgaggcccgctgggctccatccgtaacctggctatggagaaa
gttgccaactctgtactattcccatgtaaatacgcctcttcgggatgcgagataactttg
ccacacacggaaaaagcagaccacgaggagctgtgtgagtttaggccttattcctgtccc
tgtcccggtgcttcatgtaaatggcaaggctccctggatgccgtgatgccacacctgatg
catcaacataagtcaattacaacactgcagggagaagatatagtgttcctggctacggac
attaatcttcctggtgctgttgactgggttatgatgcagtcttgttttggcttccatttc
atgttagtgttggagaaacaggagaaatacgatggccaccagcagttctttgcaattgta
cagctgataggaacacgcaagcaagcagaaaactttgcttatcgactcgagctaaacggg
cataggcggcgattgacttgggaagcaactcctcggtccatccatgagggaattgcaaca
gccattatgaatagtgactgcctagtgtttgacaccagcattgcacagctctttgcagaa
aacggcaatttaggcatcaacgtaactatatccatgtgctga

DBGET integrated database retrieval system