KEGG   Empidonax traillii (willow flycatcher): 114067618
Entry
114067618         CDS       T05887                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114067618 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114067618 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114067618 (RCHY1)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114067618 (RCHY1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    114067618 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-RING_11
Other DBs
NCBI-GeneID: 114067618
NCBI-ProteinID: XP_027758984
LinkDB
Position
Unknown
AA seq 264 aa
MAAAGGAQGSEPGCARQPCEQGCEHYRRGCRLRAPCCGKLYPCRLCHDGAEEHQLDRFRV
SEVQCIRCRLLQKAQQRCEGCDSLFGEYYCDICHLFDRDKKQYHCEACGICRIGPKEDFF
HCSKCNLCLSLSLRGKHKCIENVSRQDCPICLEDIHTSRVGAHVLPCGHLLHRTCYDEML
KEGYRCPLCMHSALDMTRYWRQLDNEVAQTPMPTEYQNMMVEILCNDCNARSTVQFHLLG
MKCKNCESYNTAQDGRCRLPLEEQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atggccgcggcgggtggagcgcagggcagcgagccgggatgcgcccggcagccatgcgag
cagggatgcgagcactaccgccggggctgccggctgcgggcgccgtgctgcgggaagctg
tacccgtgccgcctgtgccacgacggcgccgaggagcaccagctggaccgcttccgagtg
tccgaggtgcagtgcatccgctgccgcctcctgcagaaggcccagcagcgctgcgagggc
tgtgacagcctcttcggcgagtactactgcgacatctgccacctcttcgaccgcgacaag
aagcagtaccactgcgaggcgtgcggcatctgcaggatcggccccaaggaggattttttc
cactgttccaaatgcaatttgtgcctgagcctgagcctccgagggaagcacaagtgcatt
gaaaatgtctccaggcaggattgtccgatatgtttggaggatattcacacgtctcgtgtc
ggagcccatgttctgccatgtggtcaccttcttcacagaacgtgttacgacgagatgctg
aaggaaggttacaggtgtcctttgtgcatgcactcggcgttagatatgaccaggtactgg
cgccagctggacaacgaagtggcacagactcccatgcccacagagtaccagaacatgatg
gtggagatcctttgcaatgactgcaatgcccgctccacggtgcagttccatctcctgggc
atgaagtgcaagaactgtgagtcctacaacactgcccaggacggacggtgccggctgccc
ttggaggagcagtga

DBGET integrated database retrieval system