KEGG   Empidonax traillii (willow flycatcher): 114067866Help
Entry
114067866         CDS       T05887                                 

Definition
(RefSeq) acyl-CoA 6-desaturase-like
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00592  alpha-Linolenic acid metabolism
etl01040  Biosynthesis of unsaturated fatty acids
etl01100  Metabolic pathways
etl01212  Fatty acid metabolism
etl03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    114067866
   01040 Biosynthesis of unsaturated fatty acids
    114067866
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    114067866
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etl01004]
    114067866
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     114067866
Lipid biosynthesis proteins [BR:etl01004]
 Desaturase
  Front-end
   114067866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 114067866
NCBI-ProteinID: XP_027759374
LinkDB All DBs
Position
Unknown
AA seq 438 aa AA seqDB search
MGKQIHFGFKVELKPQTVITEVEVTSCPSFTGTWGAQLLEVDGNDTVNRRHILISQLLLF
PLQDAFQAFHINPTLVQKFLKPLLIGELAPGEPSQDRGKNSQLVEDFRTLRKTAEDMKLF
RASPLFFSLYLGHIIAMEVLAWLMVSYFGTGWITTLILACILTTSQAQAGWLQHDFGHLS
VFKKSSWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGDTQP
VEYGKKKLKYLPYNHQHEYFFLIFPPLLIPVYFQIQIISTMIRRRFWADLAWAISYYLRY
FITYIPFYGLLGSLCLLTFVRFLESHWFVWVTQMNHIPMEIDSEKHRDWLSSQMAATCNI
EQSFFNDWFTGHLNFQIEHHLFPTMPRHNFWKVKPLVKSLCAKYGVQYEEKPLGKAFVDI
VGSLKKSGDLWLDAYLHK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaaatccattttggatttaaagtggaattaaagccccaaacagtgatcaca
gaggtggaggtcacctcctgcccctctttcacgggtacatggggggcacagctgctggaa
gtggatgggaatgatacagtgaatagaaggcacattttgatctcacagttactcctgttt
ccactccaggatgcattccaggctttccatatcaatcccaccttggtgcaaaagtttctc
aagccgttgcttattggagaacttgctccaggggagcccagccaggaccgaggtaaaaac
tcccagctggtggaggatttccggaccctgaggaagactgcagaggacatgaaattgttc
agagcaagccctttgttcttctctctttacttgggccacattattgcaatggaagtgttg
gcctggctgatggtttcatactttggtactggctggatcacgaccctcatcctggcctgc
atccttacgacttcccaggcccaggcagggtggctgcaacacgattttggacacctgtct
gtctttaagaaatcttcctggaaccacatcgtccacaagtttgtcattggacacctgaag
ggtgcctctgcaaactggtggaaccaccggcacttccagcaccacgccaagcccaacata
ttccacaaggacccagatgtgaacatgctgcacgtttttgtccttggagacacacagcct
gtcgagtatggcaagaagaagctgaagtacctgccttacaaccaccagcacgagtacttc
ttcctcatcttcccacctctgctcatccccgtgtacttccaaatccaaatcatctcgacc
atgatcaggcgcaggttctgggcggacctggcctgggccatcagctactacctgcgctac
ttcatcacatacatccccttctacggcctgctgggatccctgtgcctcctcacgttcgtc
aggtttctggagagccactggttcgtgtgggtcacccagatgaaccacattccaatggaa
attgattctgagaagcacagagactggctgagctctcagatggcagccacctgcaacatc
gagcagtccttcttcaacgactggttcaccgggcacctgaatttccagatcgagcaccac
ctgtttccaacaatgccacggcacaatttctggaaggtgaagcctttggtgaagtcgtta
tgtgccaagtatggagtccagtatgaggagaagcctcttgggaaagcttttgtagacatt
gttgggtccctaaagaaatctggtgacctgtggctggatgcttatctccacaagtga

DBGET integrated database retrieval system