KEGG   Empidonax traillii (willow flycatcher): 114067926
Entry
114067926         CDS       T05887                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04371  Apelin signaling pathway
etl04510  Focal adhesion
etl04530  Tight junction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114067926 (CCND1)
   04340 Hedgehog signaling pathway
    114067926 (CCND1)
   04371 Apelin signaling pathway
    114067926 (CCND1)
   04068 FoxO signaling pathway
    114067926 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114067926 (CCND1)
   04115 p53 signaling pathway
    114067926 (CCND1)
   04218 Cellular senescence
    114067926 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114067926 (CCND1)
   04530 Tight junction
    114067926 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114067926
NCBI-ProteinID: XP_027759498
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcaaaagtgcgaagaggaagttttccccttg
gctatgaattacttggacagatttttgtcttttgaacccctcaagaaaagccggttgcaa
ctgctcggagctacctgcatgtttgtggcttcaaaaatgaaggagactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggccgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgggcctgccaagaacagattgaatccctcctggaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system