KEGG   Empidonax traillii (willow flycatcher): 114068068
Entry
114068068         CDS       T05887                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114068068 (SFN)
   04115 p53 signaling pathway
    114068068 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114068068 (SFN)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114068068 (SFN)
  Exosomal proteins of colorectal cancer cells
   114068068 (SFN)
  Exosomal proteins of bladder cancer cells
   114068068 (SFN)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM
Other DBs
NCBI-GeneID: 114068068
NCBI-ProteinID: XP_027759743
LinkDB
Position
Unknown
AA seq 246 aa
MARNHQVQKAKLAEQAERYEDMADFMKAVVEHGDELSNEERNLLSVAYKNVVGCQRSAWR
VISSIEHKTEEGDDKAQLVNEYREKVERELNGVCNNVLALLDKYLIKKASDPESKVFYLK
MKGDYFRYLAEVATGDDRKKTIENAQEAYQEAMDISKKEMQPTNPIRLGLALNFSVFHYE
IANAPEQAISLAKTTFDEAMGDLHTLSEDSYKDSTLIMQLLRDNLTLWTAECAGEDGGEA
GEEPKN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaagaaaccaccaagtgcagaaggccaagctggccgagcaggctgagcgctacgag
gacatggcagacttcatgaaggccgtggtggagcacggggacgagctgtccaacgaggag
cgcaacctcctgtcggtggcctacaagaacgtggtgggctgccagcgctcggcctggagg
gtcatctccagcatcgagcacaaaaccgaggagggcgacgacaaggcacagctggtgaac
gagtaccgggagaaggtggagcgggagctgaacggcgtctgcaacaacgtcctggccttg
ctggacaagtatctcatcaagaaggcgagcgaccccgagagcaaggtcttctacctgaag
atgaagggcgactacttccgatacctggccgaggtggccaccggggacgaccgcaagaag
acgatagagaacgcccaggaagcctaccaagaggccatggacatcagcaaaaaggagatg
cagcccacgaaccccatccgcctggggctggccctcaacttctccgtgttccactacgag
atcgccaacgcgcccgagcaggccatctccctggccaagaccaccttcgacgaggccatg
ggggacctgcacacgctcagcgaagactcctacaaggacagcaccctcatcatgcagctg
ctcagggacaacctcacgctatggacagccgagtgcgccggggaagacggcggcgaggct
ggcgaagagcccaagaactga

DBGET integrated database retrieval system