KEGG   Empidonax traillii (willow flycatcher): 114068081
Entry
114068081         CDS       T05887                                 

Gene name
COP1
Definition
(RefSeq) E3 ubiquitin-protein ligase COP1 isoform X1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114068081 (COP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114068081 (COP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114068081 (COP1)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114068081 (COP1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    114068081 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     114068081 (COP1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 zf-rbx1 WD40_like zf-RING_4 zf_C2H2_10 Prok-RING_4
Other DBs
NCBI-GeneID: 114068081
NCBI-ProteinID: XP_027759768
LinkDB
Position
Unknown
AA seq 626 aa
MLVKTSLNRDWCGPVGVRGDSLYLCNGLKASPICFDMIEEAYMTKCGHSFCYKCIHQSLE
DNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRSEEKRLKLDHSVSSTNGHRWQIIQDL
LGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKE
LSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKK
QPWYNSTLASRRKRLTAHFEDLEQCYFSTRMTRVSDDSRTTSQLDEFQECLSKFTRYNSV
RPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPEN
EMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMD
PKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL
RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF
VGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCW
RALPDGESNVLIAANSQGTIKVLELV
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgctggtgaaaacctctctgaaccgagattggtgtggacctgtgggagtgagaggagat
tctttgtatctctgtaatggcttgaaagcaagccccatctgttttgatatgattgaagaa
gcctacatgacgaaatgtggacacagcttctgctacaaatgcattcaccagagcttggag
gataacaacaggtgtcccaaatgcaactatgtggtggacaacatagatcatctttatccc
aacttcttagtcaatgaacttattcttaaacagaagcaaagatctgaggagaaaagactc
aaactggaccattcagtgagtagcaccaacggccacaggtggcagataattcaagatttg
ttgggaacagatcaagacaatcttgacttggccaacgtcaacctgatgctggagctgctg
gtgcagaagaagaagcagttggaagcagaatcccatgctgcccaattgcagatccttatg
gaattcctcaaagttgccaggagaaacaaacgagagcaactggagcagatccagaaggag
ctaagtgttctggaagaagatattaagcgagtagaggagatgagtggcttgtactcccca
gtcagtgaggacagcacggtgccacagtttgaggctccctcaccgtcacacagcagtatt
attgactccacggagtacagccagcccccaggcttcagtggcagctctcagaccaaaaag
cagccgtggtataacagcacgctcgcctcgcgacgcaagcgcctcacagctcattttgag
gacctagagcagtgctatttttccaccaggatgactcgtgtctcagatgacagcagaacc
accagccagctggatgagtttcaagagtgtctatccaagttcacacgctacaattctgtc
cgacccctggcaacgctgtcctacgccagtgacctctacaatggctccagcatagtgtcc
agtattgagttcgaccgagactgtgactactttgccatcgccggggtgacaaagaagatt
aaagtctatgagtatggtacagtcattcaggatgcggtggatattcactaccctgagaat
gaaatgacctgtaattccaaaatcagctgtatcagctggagtagttaccacaagaacctg
ctcgccagcagtgactatgaaggcactgtcatcctttgggatggattcacaggacagaga
tccaaggtctaccaggagcatgagaaaaggtgctggagtgttgactttaacttgatggac
ccaaagctattggcttcaggctctgatgatgccaaagtgaaactgtggtctaccaatttg
gacaactcagtagcaagcatcgaggccaaggctaacgtgtgctgtgtgaaattcagcccc
tcttcaaggtatcacctagcttttggctgtgcagatcactgtgttcactactacgacctt
cgcaacactaagcagcccatcatggtgttcaaagggcaccgcaaggccgtgtcctacgcc
aaattcgtgagcggggaagagatcgtctctgcgtcaacagacagtcagctgaagctgtgg
aacgtagggaagcctcactgcttgcgctccttcaagggtcacatcaacgagaagaacttt
gtagggcttgcatccaacggagactacattgcctgtggaagtgaaaataattccctgtac
ttatactataagggcctctcaaagacactgctgacgttcaagtttgatacagtcaaaagc
gtcctggacaaggaccggaaagaagacgacacaaatgagtttgtgagcgccgtgtgctgg
agggcactgccagatggggagtccaatgtgctgattgctgctaacagtcagggtacaatt
aaggtactggagctggtatga

DBGET integrated database retrieval system