KEGG   Empidonax traillii (willow flycatcher): 114068363
Entry
114068363         CDS       T05887                                 

Gene name
GPR161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114068363 (GPR161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114068363 (GPR161)
G protein-coupled receptors [BR:etl04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    114068363 (GPR161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Other DBs
NCBI-GeneID: 114068363
NCBI-ProteinID: XP_027760180
LinkDB
Position
Unknown
AA seq 545 aa
MFLSIVLPLAAQHVLAAPALHALTMSSNSSLGNVKGLRNLTTQEDGAVRVTESIAIIVIA
IFICLGNLVIVVTLYRKSYLLTLSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVV
WCNFSALLYMLISSASMLTLGLIAIDRYYAVLYPMVYPMKITGNRAVVALVYVWLHSLIG
CLPPLFGWSSLEFDQFKWMCVAAWHKEAGYTAFWQIWCALLPFVVMMICYGFIFRVARIK
ARKIHCGSVVIVEEDSQRNGRKNSSTSTSSSGSRRNAFQGVVYSANQCKAFITILVVIGA
FVITWGPYMVVITSEALWGKNSISPALETLATWLSFSSAICHPLIYGLWNKTVRKELFGM
CFGDRYYRESFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGRPLGNSSSTGDTGFSCS
QDSGTDTMLLEDYSSDGPHAPHCVCPPRRRSSVTFEDEVEQIKEAAKNSVLHVKAEVHKS
LDSYATSLARAIEADVKLSLFGEDALPGALFPVRTLPGGSMNTRRGARPHASQRLKLQSI
DEGNI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtttctgagcattgttctgcctctagctgctcagcatgtcttggctgctccagctctg
cacgctctgaccatgagcagcaattcctccctcggcaatgtgaagggcctgaggaacctc
accacgcaggaagatggggcagtcagagtcaccgagtccattgctatcatcgtcatcgct
attttcatctgtttgggcaacctggtgattgtcgtcaccctgtatcgaaagtcttacctt
ctcaccttgagcaacaagtttgtgttcagcctgaccctttccaactttctgctctctgta
ctggtgctgccttttgttgtcaccagctccatcaggcgagaatggatcttcggagttgtt
tggtgcaatttctcagccctgctctacatgctgatcagctcagccagcatgctgaccctt
ggactcatagctatagaccggtactatgctgtcctgtacccgatggtttacccaatgaag
ataacgggcaacagagcagtggtagctcttgtgtacgtgtggctgcattcccttattggc
tgcctccctcctctttttggctggtcgtctttagagtttgaccagttcaagtggatgtgc
gtggcggcctggcacaaagaggccggctacactgccttttggcagatctggtgcgcgctg
ctgcctttcgtggtcatgatgatctgctatgggttcatattccgtgtggcgaggattaag
gcccgcaaaatccactgtggtagtgtcgtcatcgtggaggaggactcgcagaggaacggg
aggaagaactccagcacctccacgtcctcgtctggcagccgaagaaatgctttccagggg
gttgtttactcggccaaccagtgcaaagctttcataaccatcttggttgtcatcggggct
ttcgtgattacgtgggggccttacatggtagtaattacatcagaggcactttggggaaaa
aacagtatttcccctgccttggagacattggctacgtggttgtccttttccagtgccatt
tgccatccgctaatttatggactgtggaacaagacagtgcgcaaggaactctttgggatg
tgctttggggatcggtattatcgtgagtcctttgttcagcggcagaggacatcgaggtta
ttcagcatttccaacaggatcacagatttgggtctatctcctcatcttactgccctcatg
gcaggtggacggccattaggaaacagcagcagcacaggagacacaggtttcagctgctca
caggattcaggaacagatacaatgcttcttgaagattacagctcagatggccctcatgcc
ccacactgtgtctgtcctcctcgaaggaggagttcagtgacatttgaagatgaagtagag
caaattaaagaagctgcgaagaattccgttcttcatgtaaaagccgaagtccataaatct
ctggacagttatgcaaccagtctagcaagagctatcgaagctgacgtgaaactcagcttg
tttggggaagatgctttaccaggagccctgttcccggtgcggactctgccaggaggcagc
atgaacacacggcgtggtgccaggccccatgctagccaaagactgaagttgcagagcatc
gatgaagggaatatttga

DBGET integrated database retrieval system