KEGG   Empidonax traillii (willow flycatcher): 114068393
Entry
114068393         CDS       T05887                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114068393 (IGFBP3)
   04218 Cellular senescence
    114068393 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114068393 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114068393 (IGFBP3)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    114068393 (IGFBP3)
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   114068393 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP DUF4829
Other DBs
NCBI-GeneID: 114068393
NCBI-ProteinID: XP_027760219
LinkDB
Position
Unknown
AA seq 285 aa
MVPRPGVLWAVAAAALALLVRRAAAALAGPVVRCEPCDARALQQCKPLQPDCAERVREPG
CGCCLTCALRPGQPCGIYTERCGAGLSCQPRPEEARPLQALLEGRGLCTNATAGGRLRAF
LLPAPRAAGNSSDSEEDQSTSSIENQAVPNSHRVPDSKLHPPHIKIDIIRKVQAKDTQRY
KVEYDSQSTDTLNFSSESKQETEYGPCRREMEDTLKHLKILNVLSPRGFHIPNCDKKGFY
KKKQCRPSKGRKRGYCWCVDKYGQPLPGYDGKGKGDVHCYNLESK
NT seq 858 nt   +upstreamnt  +downstreamnt
atggtgccgcggcccggcgtgctgtgggcagtggcggcggcggcgctggcgctgctggtc
cggcgggcggcggcggcgctggcggggccggtggtgcggtgcgagccctgcgacgcgcgg
gcgctgcagcagtgcaagcccctgcagcccgactgcgccgagcgggtgcgggagccgggc
tgcggctgctgcctcacctgcgccctgcgccccgggcagccctgcggcatctacacggag
cgctgcggcgcggggctcagctgccagccgcggccggaggaggcgcggccgctgcaggcg
ctgctggagggccgcgggctctgcaccaacgcgacggcgggcggcaggctgcgggccttc
ctgctgccggcaccgcgcgctgcaggaaattccagtgattcagaagaagaccagagtacc
agcagcatagaaaatcaggccgttccaaactctcacagggtgccagattccaagttgcat
ccaccacatatcaaaatagatatcatcaggaaagtgcaagccaaagatacacagcgctat
aaagtggaatacgattcgcagagtacagatacactgaatttttcttctgagtccaaacaa
gagactgagtatggtccatgtcgtagagaaatggaagacactttaaagcacctaaagatc
ctgaatgtcttgagtccaaggggctttcatattccgaattgtgacaagaaggggttctac
aagaaaaagcaatgtcgcccgtccaaaggccgaaaaagaggttattgctggtgtgtggat
aaatatggacagccgcttcccgggtacgatgggaagggaaaaggagatgtccactgctat
aacttggaaagcaaatga

DBGET integrated database retrieval system