KEGG   Empidonax traillii (willow flycatcher): 114068482
Entry
114068482         CDS       T05887                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114068482 (PIDD1)
   04115 p53 signaling pathway
    114068482 (PIDD1)
SSDB
Motif
Pfam: LRR_8 LRR_4 ZU5 Peptidase_S68 Death
Other DBs
NCBI-GeneID: 114068482
NCBI-ProteinID: XP_027760409
LinkDB
Position
Unknown
AA seq 935 aa
MVHLCSLSAPSFLFLLVPAASWCRWFLPARQVRACPDPMEEMQKMAERLSLWGKCGEGTS
GAPALAGPCLAGNRLSLDVYPDGCWHFLRLLKQQREEVVQVEFLRLSSNDCLIDTTLDSL
PHLEHLKSLVLKGGHVRDKFGSCQRGSLTSLPQDFGNLKCLTHLDLSFNRLSTLPSCIVH
LPSLRVLLVSHNSLVALPEDFGCLSKLTFFSAMKNQLTDLPQSIGELSMLHSLDLSENFL
ELLPEEIGNLQNCEELVLSGNCLSSIPDSLGNLKSLRELHLHTNFLVTVPASLASLPNLS
RLDLQNNCLRAVPAEIQALPFVDLHGNPLGETEPSLQADESSARGLRRLSCRSGKNRSFL
VTSEGCEVVLPYGIHFCFPPGAASDTLRISFRILEPDPQWVKLRHHDVLLSRVLELRPHG
IKFQQEVQIWIPFVPPQILHQNEVVVRTFSGQSWSDLRTRVEQKRGSMMAHCSVLHFSWF
LVVSRLVQDECKVPAEGTLLFSSVDPNIKVIFPPGVTKEPRSVKMQVLQVPAKEMDEITA
SAGCRASPLLCLSQDSLVDFLNPVTIQLPLPHGVTGLNLDQLRLRLLHGDPEGQTWDDIT
SKVVLKFTHIYVMFEVTHFSWYWLWYTTKTYIEGIAKKVYERLRLYQVNFIALQRKKDPE
QVLLQCVPKHKVDTVLQRLQNRYQGPEPSDMVEMFEGEQFFAAFERGISIDMDRPDYVDG
RLSFIFYSHLKNMKEVYVTSPVDRKGQAVKGQVSFYRGAVPQNIPEDASRRRKGADSLWL
ATLPIKLPQLKSRCNENPGPLCGFSFPPLNLGNAETGYLTQANLLSIARRVGSDWQTIGL
NLGLTFQQIERIGHNNRDDLDKQILGMLFSWAQQNSEDPDCVSKLIAAMKESGRQDIADE
VETIIDLGRQKYSESIRRVGLEPESSREDSAIATM
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggtgcacttgtgttctctttcagctccatctttcctcttcctcctcgtcccggctgcc
tcgtggtgccgctggttcctgcctgccaggcaagtcagagcatgtccagaccccatggag
gagatgcagaagatggcagagcggctgagcctctggggcaagtgcggggaggggacttcg
ggggctcctgcacttgctggcccctgccttgcaggcaacagactgagcctggatgtttat
cctgatggctgctggcatttcctccggctgttgaagcagcaacgggaagaggtggtccag
gtggagttccttcgtctcagcagcaacgattgcctcattgacaccacgctggacagcctt
cctcatctggagcacctgaaatccctggtgctgaaaggaggtcacgttagagataagttt
ggttcctgccagcgtggctccctgacaagcttgccacaagacttcgggaacctgaagtgt
ctcacccacctggatctcagcttcaacagactctccaccttgccgagctgcattgtccac
ctccccagcctccgtgtgctcctggtgagccacaacagcctggtggcacttcctgaggac
tttggctgtcttagcaagttgactttcttctctgctatgaaaaatcagctgacggactta
cctcagagcattggggagctgtcaatgctgcatagcctggatctttcagaaaattttttg
gaattgcttcctgaagaaattgggaatctgcagaactgtgaagagctggttctctctgga
aattgcttatcgagcatcccagactccttaggcaatttgaagtctctgcgtgagctgcat
ctccacaccaatttcctggtgacggtccctgcctcgcttgccagcctgcccaacttgtcc
agacttgatctgcagaacaactgcctccgtgctgtccccgctgagatccaggctttgcca
tttgtggacctccatggcaatcccttaggagaaactgaaccatctctgcaggctgatgaa
tccagtgccagagggctaagaagactctcctgtagatcgggaaagaacagaagctttctt
gtcacctctgaaggctgcgaagtggtcctgccctatggcatccatttctgctttccaccg
ggggctgcctctgatactctgcggatcagcttccgaatcctcgaaccggaccctcagtgg
gtaaagcttagacaccacgatgtcttgctgagtagggtcctggagctgcggcctcatggg
atcaaattccagcaggaggtgcagatatggattccatttgtcccacctcaaatccttcac
cagaatgaggtggtagttcggaccttcagtgggcagagctggagtgatctgagaacgaga
gtggagcagaagaggggatcaatgatggctcactgtagtgtccttcacttctcttggttc
cttgttgtgtctcgacttgtgcaagatgaatgcaaagtgccagcagaggggacattgctc
ttttccagtgtggatccaaacatcaaagtgatctttcctcctggagtcaccaaagagcct
cgcagtgtcaagatgcaggtgctgcaggtccctgcaaaagagatggacgaaatcacagcc
agtgcagggtgcagagccagtcccctgctctgcctctcccaggactccctggtggatttt
ctcaatccagtgacaattcagctgcccctcccacacggagtcacaggactaaatttggat
cagttaaggctgcgtcttctccatggtgacccggagggccaaacctgggatgacattacc
agtaaggtggtgctgaaattcactcatatttatgtgatgtttgaagtcactcacttctcc
tggtactggctgtggtacaccactaagacctacattgaaggcattgccaagaaggtctat
gagcggctgcgtctgtaccaggtgaacttcattgcactgcagaggaagaaggaccccgag
caagtcctgctacagtgtgtccccaagcacaaggttgacacagtgctgcagaggctgcag
aaccgctatcaaggacctgagccatccgacatggtggagatgtttgagggagagcaattt
tttgcagcttttgagcgaggcatcagcatcgatatggatcgccctgactatgtggacgga
cgtctgtcatttattttttactcccacttgaagaacatgaaggaagtatatgtgacctcc
cctgtggacaggaaaggccaagctgtaaaaggccaggtctccttctaccgaggagcagtt
ccacagaacatccctgaagatgccagcaggaggaggaaaggagcagactccctctggctt
gctactctgcccatcaaactacctcaattgaagtcccgctgcaatgagaatcctggtccc
ctgtgtggcttctccttccctcccttgaacctgggcaatgctgagaccggctacttgaca
caggcaaacctgctgagcattgccaggcgtgtgggatctgactggcagaccattggcctc
aacctgggcttgacctttcagcagattgagcgcataggacacaataatagagacgacctt
gataagcagatcttgggcatgcttttctcatgggctcagcaaaactcggaggatcctgac
tgtgtgagcaagctgattgcagccatgaaagagagtggccgccaggacatcgctgatgag
gttgaaaccatcattgatctgggacgacagaaatacagcgagtccatccgccgcgtgggc
ttggagccggagagcagcagggaggactcagcaatagctacgatgtag

DBGET integrated database retrieval system