KEGG   Empidonax traillii (willow flycatcher): 114068714
Entry
114068714         CDS       T05887                                 

Gene name
FHAD1
Definition
(RefSeq) forkhead-associated domain-containing protein 1
Organism
etl  Empidonax traillii (willow flycatcher)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 114068714
NCBI-ProteinID: XP_027760858
LinkDB
Position
Unknown
AA seq 1270 aa
MRAFLKSSEGCFQLKPHTTTIGSHRGADIVLQSPGVADRHAALEFSASDNSFVLQDFNSP
HGTFVNSCHVQNAAVGVRPGDILRFGTAGPAFELVLDGAAQMSRPPLKRRTGWTGQLQVV
AEPKPSAPVSPPRLPLLQWQHPPGSPGSGTRGAPGHQPHPPLLRRPLSARDRSVASAASL
DTFSRTSAGRAVSTSFSGDCASSVGGAPSLGTHNTDLLQQEKGEKLLQLEQEMGHLSGLE
TESKHKDVVIRDLQEEVEATAKKLAQAAARNEVELTQKLLAFNQELGAKTEEIKALREQI
SDLQKGSSQVFSHSLYERDLEIGRLQRESEKLKRDQALTAGLVSSLQREVLQKEQKIQRL
QQEIEKLKKENREKDNQLAVVSAKCSRIKEETKRELGEQEIISCRNRIGELERDLEGLQM
EIQKHCAKQETVQKQLAEKTKVEEELEAACARQAGQLREMGRRERLLRVDLRRAREQLES
FKTQVMQVCSPSAAGSTGKSITEQQVIEKVRQICDENQQSHEREKCLQDELSSRLMKEKE
VSANTEVLKNSLWELQACLRSSCSSASLRGELEQLEVVSLDPSISAIRTAVVDMASVPLS
WLEDLEQLLAGAGMDLCTSGQGLLAAFRSLLEKTQEVAQRNQLLQEQLERLQQSQAEMLQ
ENTKELEAKHEQDLEIKIQQITLEKDKENKEVLESALAEEKDKCEKRVEEEQRKIQELES
HLRSMAEATARKAEEQEVTEGKLKEALRELEETTAREVLLQQQVLVQDKQLRALQEDKEL
QRQKLQEEIAGYREQSKQHSLTIVALEGRLLEATQEQKVLEEEKAALVEKMEGTQRGAHK
PGSGAWLEVCPATESHVCLGKLREELAVAQRVLLEKEAFIGRLTRELSESRARMSDMRGE
LSEEQKVELEKNQRCLKHREREVNQLREKLSQMSNLVEEKDRSLKAAAEELRRAQARCHV
LRDASQQTVEKLEDAPRTPVRAGEASQRVPPLDLADLGAKCRGLRHEETIQRQKEGLAEL
RERVKMLEKRQSSGAVKKRLEPLVKDLPEEIVQHTGLEMEPAPMSGAKLKAGKAPGHVPT
GGSLRITNRAASLERAEVTDLGEKMYLDVIGALGSLVEMKELSGMQPLQHLPREEREEAG
LQRRRALELLCKKIRNLQHRLERKEEMLKDYEGSMEQLRQNQASLRRCQEEMSNLEDEAH
REAEEKALLREALERTQLQLEREKRLRRAAKRHKPGATKEAQTSQEPKSTRQMLSRREAH
KRGTTGAFSR
NT seq 3813 nt   +upstreamnt  +downstreamnt
atgcgagccttcctaaagagctccgaggggtgtttccagctgaaaccccacaccacgacc
atcgggagccacagaggggccgacatcgtcctgcagtccccaggtgtagcagatcgtcac
gcagccctggaattctccgcctcggacaatagcttcgtcctccaggacttcaactccccc
cacggcacctttgtcaacagctgccacgtccagaatgcggccgtgggggtgaggccgggg
gacatcctgcgcttcggcaccgcgggacccgccttcgagctggtgctggatggggctgcc
cagatgtcccgtccccccttgaaacgccgcacagggtggacggggcagctccaggtggtt
gcagagcccaaaccctcggctcctgtgtctcctccccgcctgcccttgctgcagtggcag
catccccctggctctccaggcagtgggactcgtggagcccccggccaccagccccatcca
ccgctgctgaggagacccctgagcgcccgggacaggagcgtggccagcgctgcctctctg
gacaccttcagcaggacctctgcggggagggcagtctcaaccagcttctcaggtgattgt
gcaagcagtgtgggaggagccccttccctggggactcacaacacggatctcctccagcag
gagaagggtgagaagctgctgcagctggagcaggaaatgggtcacctgtctggtttggag
acagagtcaaagcacaaagatgtggtgataagagatctgcaggaggaggtggaggccacg
gcaaagaaactggcccaggcggcggcgaggaacgaggttgaactgacccagaagctgctg
gccttcaaccaagagctgggagccaaaacagaggagatcaaagccctgagggaacagatc
agtgacctgcagaaaggctcgagccaggttttcagccattccctctatgaaagagacctg
gaaattgggaggctccagagagaaagcgagaagttgaagagggaccaggctttgactgca
ggcctggtgagcagcctgcaaagggaggtcctgcagaaggagcagaaaatccagcgactc
cagcaagagattgaaaaactgaagaaggaaaatcgagagaaggacaaccagctggcagtt
gtttctgccaagtgctcgagaattaaagaggaaacgaagcgtgagcttggagagcaagaa
ataatcagctgtcgaaatcgcattggggagctggaacgggacctggaggggctgcagatg
gaaatccagaagcattgtgccaagcaggagaccgtccaaaagcagctggctgagaaaacc
aaggtggaggaggagctggaggcagcctgtgcccggcaggcggggcagctgcgggagatg
gggcgcagggagcggctgctgcgagtggacctgcggcgggcaagggagcagctggagtcc
ttcaagacccaagtgatgcaagtctgttctccatcagcagcaggcagcacagggaaatcc
ataacggagcagcaggtgatagagaaggtcaggcagatctgcgatgagaaccagcagagt
catgagagggagaagtgtctgcaggatgagttaagctccaggctcatgaaggagaaggag
gtgtctgcaaacactgaggtgctcaagaactccctgtgggagctccaggcttgcctgagg
agctcctgcagcagcgccagcctgcgaggggagctggagcaactggaggtggtgtccctg
gatccctccatctcagccatcaggacagcagtggtggacatggccagtgtccccctctcc
tggctggaggacctggagcagctcttggccggtgcggggatggacctgtgcacctctggc
caagggctgttggctgctttcaggagcttgttggaaaagactcaggaagtggcccagagg
aatcagctgttgcaggagcaattagagaggctccagcagtcgcaggcagagatgctgcag
gagaacacaaaggagctggaagcaaaacatgagcaagacttggagataaaaatccagcaa
attaccctggaaaaggacaaggagaacaaagaggttctggaaagcgctctcgctgaggag
aaggacaagtgtgagaaacgtgtggaggaagagcagaggaagatccaagagctggaaagc
catctgagaagcatggctgaggcaacagcaaggaaggcagaggagcaggaggtgacagag
ggcaaactgaaagaagctttgcgtgagctggaggaaaccactgcccgagaggtgttgtta
cagcagcaggtgctggtgcaggacaagcagctcagggctctccaggaggacaaggagcta
cagaggcagaaactgcaggaagaaatagcaggatacagggagcaaagcaagcagcattcc
ctgaccatcgtggctttggagggcaggctgctggaggccacgcaggagcagaaggtgctg
gaggaggaaaaggcagcacttgtggaaaaaatggaaggaactcagcgtggtgcccacaag
ccaggatcgggagcttggctggaggtttgtcctgccacggagtcacacgtttgtctgggg
aaactgcgggaggagctggcggtggctcagagggtgctcctggaaaaggaggccttcatt
ggcaggctcaccagggagctgtcggaaagcagggccaggatgtcggacatgagaggggag
ctgagtgaggagcagaaggtggagctggagaagaaccagagatgcctgaaacaccgggag
cgggaagtgaaccagctcagggagaagctgtcccagatgtccaacctcgtggaggagaag
gatcgatccctgaaagcagcagctgaagagttaaggcgagcccaagcccgttgccacgtg
ctgagggacgcctcccaacaaacagtggaaaagctggaggatgctcccaggacgccagtg
cgggcgggggaagcctcccagagggtgccaccgttggacttggctgaccttggtgcaaaa
tgccgaggcctcaggcacgaggaaacgatccagcgccaaaaggaaggtctggctgagctc
cgggagagagtaaagatgctggagaagaggcagagctcaggtgctgtgaagaagcgtttg
gagccactggtgaaagacttaccagaggagatagtccagcacacagggcttgagatggag
cctgcacccatgtcaggagcaaaattgaaggctggcaaggctcctggccatgttcctact
gggggctccctcaggatcaccaacagggcagcaagcttggagagggctgaggtgacagac
ctcggtgagaagatgtaccttgatgtgatcggtgctctgggaagcctggtggagatgaag
gagctgtcgggaatgcagcccctgcagcaccttcctcgggaggagagggaagaagcggga
ctgcagaggcggagggccctggagctgctgtgcaaaaagatcaggaacctccagcaccgc
ctggagaggaaagaagaaatgctaaaagattacgagggaagcatggagcagctgaggcag
aaccaagcatccctgcggaggtgccaggaggagatgtccaacctggaagatgaagcccac
agggaggcagaagagaaggctctgctgcgagaggctctggagaggacccagctccagctg
gagcgggagaagaggctgcggcgagcggccaaacggcacaagcctggagccacgaaggag
gctcagacaagccaagagccaaagagcacacggcagatgctgtccagaagggaagctcac
aagagaggcaccacaggggcgttcagcaggtga

DBGET integrated database retrieval system