KEGG   Empidonax traillii (willow flycatcher): 114068717
Entry
114068717         CDS       T05887                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04370  VEGF signaling pathway
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    114068717 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114068717 (CASP9)
   04115 p53 signaling pathway
    114068717 (CASP9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114068717 (CASP9)
   05168 Herpes simplex virus 1 infection
    114068717 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etl01009]
    114068717 (CASP9)
   01002 Peptidases and inhibitors [BR:etl01002]
    114068717 (CASP9)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     114068717 (CASP9)
Protein phosphatases and associated proteins [BR:etl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114068717 (CASP9)
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C14: caspase family
   114068717 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 114068717
NCBI-ProteinID: XP_027760862
LinkDB
Position
Unknown
AA seq 418 aa
MEERHRRALRRGRARLVAALRVEPLWEPLERRGIFTRTMLEELQSTGGRGDQARQLVIDL
ETRGKQAFPVFLSILRDTGQGDLADMLDQGCESPLAPPQLLDLQPVELELRGEKQHKTVT
LPERLSFPVQAESEKPRTPVPAQGSAVDKKSHDLVYELKADPCGHCLILNNVTFSRDSHL
STRVGSDRDCEKLERRFRALRFDVLTRRDLKAQEMVLELQKLARRDHSALDCCIVVILSH
GCQTSHIQFPGGVYGTDGKPIPIEKIVNYFNGSNCPSLRGKPKLFFIQACGGEQKDRGFI
VDCDSPKDEAPGASLESDATPFQAPSGNVDEPDAIACLPTPSDILVSYSTFPGFVSWREA
TGSWYVETLDSVLERYARSEDLLNMLLRVANAVSAKGSYKQIPGCFNFLRKKFYFVCD
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagcggcatcggcgggcgctgcggcgcgggcgggcccggctggtggcggcgctg
cgggtggagccgctctgggagccgctggagcggcgaggcatcttcacccgcaccatgctg
gaggagctgcagagcaccggcggccgaggagaccaagcccggcagctggtcatcgacctg
gagactcgagggaagcaggctttccccgtgttcctgtccatcctgcgggacacggggcag
ggtgacctcgcggacatgctggaccaggggtgcgagtccccgctggcaccgccgcagctg
ctggacctgcagcccgtggagctggagctgcggggagaaaagcagcataaaactgtgacc
cttcccgagcgtttgtccttcccagtccaagctgagagcgaaaaacctcgaacacctgtg
ccagcccagggttctgctgttgacaagaagagccatgatctggtttatgagctgaaagca
gatccctgcgggcactgcctgatcctcaacaacgtcaccttctccagagactcccatctg
tcgacccgcgttggctccgaccgcgactgtgagaagctggagcggcgcttcagggccttg
cgcttcgacgtcctgacccggcgggacctgaaagctcaggaaatggttttggagctgcag
aagctggcgcggcgggaccacagcgccttggactgctgcatcgtggtcatcctttcccat
ggctgtcagacgagccatattcagtttcccggaggcgtttacggaacggatggaaaaccc
attcccatagaaaagattgtgaactatttcaatgggtccaattgcccaagtttgagagga
aagcccaaactcttcttcatccaggcctgtggtggagaacaaaaggatcgaggcttcata
gtggattgcgattcacccaaagatgaagctcctggagcttctttggaatcggacgcgact
ccttttcaggctccatcgggtaacgtggatgagccagatgccattgcctgtttgcccaca
cccagcgacatcctggtctcctactcgacttttccaggttttgtctcctggagggaggcg
actggctcgtggtacgttgaaacactggacagcgtgctggagagatatgcccgttcagaa
gacctgctcaacatgttactgcgggtggcaaacgctgtctcagccaaggggagctacaag
cagattccaggatgtttcaacttcctccgtaaaaagttctactttgtgtgtgactga

DBGET integrated database retrieval system